summaryrefslogtreecommitdiffstats
diff options
context:
space:
mode:
authoranonym <anonym@riseup.net>2017-01-26 09:49:18 +0100
committeranonym <anonym@riseup.net>2017-01-26 09:49:18 +0100
commit95cff50c751598183c6ddf66662788b2aee57d43 (patch)
tree6fb392bd13fa3e1e526f8690bf0cf81d01b52d79
parent07e96492181f01c75c73ea98d07aa41944953055 (diff)
parent95643a2aa1ea63f34d5904e85cb13491c985348e (diff)
Merge remote-tracking branch 'origin/stable' into test/12019-totem-add-local-video-actiontest/12019-totem-add-local-video-action
-rw-r--r--config/APT_snapshots.d/torproject/serial2
-rw-r--r--config/base_branch2
-rw-r--r--config/binary_rootfs/squashfs.sort9068
-rw-r--r--config/chroot_local-includes/usr/share/tails/ublock-origin/ublock0.dump2430
-rw-r--r--debian/changelog64
-rw-r--r--features/images/ElectrumStatus.pngbin4304 -> 997 bytes
-rw-r--r--features/step_definitions/common_steps.rb2
-rw-r--r--features/step_definitions/pidgin.rb2
-rw-r--r--po/POTFILES.skip1
-rw-r--r--po/ar.po2
-rw-r--r--po/az.po2
-rw-r--r--po/bg.po2
-rw-r--r--po/ca.po2
-rw-r--r--po/cs.po2
-rw-r--r--po/cy.po2
-rw-r--r--po/da.po54
-rw-r--r--po/de.po2
-rw-r--r--po/el.po2
-rw-r--r--po/en_GB.po2
-rw-r--r--po/es.po2
-rw-r--r--po/fa.po2
-rw-r--r--po/fi.po2
-rw-r--r--po/fr_CA.po2
-rw-r--r--po/he.po2
-rw-r--r--po/hr_HR.po2
-rw-r--r--po/hu.po2
-rw-r--r--po/id.po2
-rw-r--r--po/it.po2
-rw-r--r--po/ja.po2
-rw-r--r--po/km.po2
-rw-r--r--po/ko.po2
-rw-r--r--po/lv.po2
-rw-r--r--po/nb.po8
-rw-r--r--po/nl.po2
-rw-r--r--po/nn.po2
-rw-r--r--po/pl.po2
-rw-r--r--po/pt.po2
-rw-r--r--po/pt_BR.po2
-rw-r--r--po/ro.po2
-rw-r--r--po/ru.po2
-rw-r--r--po/sk.po2
-rw-r--r--po/sk_SK.po2
-rw-r--r--po/sl_SI.po2
-rw-r--r--po/sq.po2
-rw-r--r--po/sr.po2
-rw-r--r--po/sv.po2
-rw-r--r--po/tails.pot2
-rw-r--r--po/tr.po2
-rw-r--r--po/uk.po2
-rw-r--r--po/vi.po2
-rw-r--r--po/zh_CN.po2
-rw-r--r--po/zh_HK.po2
-rw-r--r--po/zh_TW.po2
-rwxr-xr-xrun_test_suite2
-rw-r--r--wiki/src/blueprint/Debian_Stretch.mdwn2
-rw-r--r--wiki/src/blueprint/Linux_containers.mdwn2
-rw-r--r--wiki/src/blueprint/monthly_report/report_2016_12.mdwn78
-rw-r--r--wiki/src/blueprint/tails_server.mdwn16
-rw-r--r--wiki/src/contribute/how/documentation/release_notes.mdwn17
-rw-r--r--wiki/src/contribute/meetings/201701.mdwn42
-rw-r--r--wiki/src/contribute/release_process.mdwn7
-rw-r--r--wiki/src/contribute/release_process/test.mdwn15
-rw-r--r--wiki/src/doc/about/features.de.po3
-rw-r--r--wiki/src/doc/about/features.fa.po3
-rw-r--r--wiki/src/doc/about/features.fr.po3
-rw-r--r--wiki/src/doc/about/features.it.po3
-rw-r--r--wiki/src/doc/about/features.mdwn1
-rw-r--r--wiki/src/doc/about/features.pt.po3
-rw-r--r--wiki/src/doc/anonymous_internet.index.de.po16
-rw-r--r--wiki/src/doc/anonymous_internet.index.fa.po3
-rw-r--r--wiki/src/doc/anonymous_internet.index.fr.po16
-rw-r--r--wiki/src/doc/anonymous_internet.index.it.po3
-rw-r--r--wiki/src/doc/anonymous_internet.index.mdwn1
-rw-r--r--wiki/src/doc/anonymous_internet.index.pt.po3
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.de.po174
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.fa.po135
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.fr.po172
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.it.po112
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.mdwn67
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser.pt.po115
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser/circuit_view.pngbin0 -> 22900 bytes
-rw-r--r--wiki/src/doc/anonymous_internet/Tor_Browser/new_identity.pngbin16262 -> 0 bytes
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.de.po82
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.fa.po82
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.fr.po82
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.it.po82
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.mdwn34
-rw-r--r--wiki/src/doc/anonymous_internet/onionshare.pt.po82
-rw-r--r--wiki/src/inc/stable_i386_date.html2
-rw-r--r--wiki/src/inc/stable_i386_gpg_signature_output.html3
-rw-r--r--wiki/src/inc/stable_i386_gpg_verify.html2
-rw-r--r--wiki/src/inc/stable_i386_iso_sig_url.html2
-rw-r--r--wiki/src/inc/stable_i386_iso_size.html2
-rw-r--r--wiki/src/inc/stable_i386_iso_url.html2
-rw-r--r--wiki/src/inc/stable_i386_release_notes.de.po4
-rw-r--r--wiki/src/inc/stable_i386_release_notes.fa.po6
-rw-r--r--wiki/src/inc/stable_i386_release_notes.fr.po4
-rw-r--r--wiki/src/inc/stable_i386_release_notes.html2
-rw-r--r--wiki/src/inc/stable_i386_release_notes.it.po2
-rw-r--r--wiki/src/inc/stable_i386_release_notes.pt.po4
-rw-r--r--wiki/src/inc/stable_i386_torrent_url.html2
-rw-r--r--wiki/src/inc/stable_i386_version.html2
-rw-r--r--wiki/src/inc/trace2
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.de.po9
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.fa.po4
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.fr.po9
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.it.po4
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.mdwn2
-rw-r--r--wiki/src/install/inc/steps/install_final.inline.pt.po4
-rw-r--r--wiki/src/install/v1/Tails/i386/stable/latest.yml8
-rw-r--r--wiki/src/news/version_2.10.de.po207
-rw-r--r--wiki/src/news/version_2.10.fa.po207
-rw-r--r--wiki/src/news/version_2.10.fr.po207
-rw-r--r--wiki/src/news/version_2.10.it.po207
-rw-r--r--wiki/src/news/version_2.10.mdwn88
-rw-r--r--wiki/src/news/version_2.10.pt.po207
-rw-r--r--wiki/src/news/version_2.10/onionshare.pngbin0 -> 17688 bytes
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.de.po80
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.fa.po80
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.fr.po80
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.it.po80
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.mdwn21
-rw-r--r--wiki/src/security/Numerous_security_holes_in_2.9.1.pt.po80
-rw-r--r--wiki/src/shortcuts.mdwn6
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10.build-manifest (renamed from wiki/src/torrents/files/tails-i386-2.9.1.build-manifest)651
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10.iso.sig16
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10.packages (renamed from wiki/src/torrents/files/tails-i386-2.9.1.packages)417
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10.torrentbin0 -> 92637 bytes
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10~rc1.iso.sig16
-rw-r--r--wiki/src/torrents/files/tails-i386-2.10~rc1.torrentbin92649 -> 0 bytes
-rw-r--r--wiki/src/torrents/files/tails-i386-2.9.1.iso.sig16
-rw-r--r--wiki/src/torrents/files/tails-i386-2.9.1.torrentbin89500 -> 0 bytes
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10.1/i386/alpha/upgrades.yml5
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10.1/i386/alpha/upgrades.yml.pgp16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10.1/i386/stable/upgrades.yml5
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10.1/i386/stable/upgrades.yml.pgp16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10~rc1/i386/alpha/upgrades.yml15
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10~rc1/i386/alpha/upgrades.yml.pgp26
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10~rc1/i386/stable/upgrades.yml15
-rw-r--r--wiki/src/upgrade/v1/Tails/2.10~rc1/i386/stable/upgrades.yml.pgp26
-rw-r--r--wiki/src/upgrade/v1/Tails/2.11~rc1/i386/alpha/upgrades.yml5
-rw-r--r--wiki/src/upgrade/v1/Tails/2.11~rc1/i386/alpha/upgrades.yml.pgp16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.11~rc1/i386/stable/upgrades.yml5
-rw-r--r--wiki/src/upgrade/v1/Tails/2.11~rc1/i386/stable/upgrades.yml.pgp16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.7/i386/alpha/upgrades.yml16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.7/i386/alpha/upgrades.yml.pgp26
-rw-r--r--wiki/src/upgrade/v1/Tails/2.7/i386/stable/upgrades.yml16
-rw-r--r--wiki/src/upgrade/v1/Tails/2.7/i386/stable/upgrades.yml.pgp26
-rw-r--r--wiki/src/upgrade/v1/Tails/2.9.1/i386/alpha/upgrades.yml14
-rw-r--r--wiki/src/upgrade/v1/Tails/2.9.1/i386/alpha/upgrades.yml.pgp26
-rw-r--r--wiki/src/upgrade/v1/Tails/2.9.1/i386/stable/upgrades.yml15
-rw-r--r--wiki/src/upgrade/v1/Tails/2.9.1/i386/stable/upgrades.yml.pgp26
152 files changed, 9942 insertions, 6311 deletions
diff --git a/config/APT_snapshots.d/torproject/serial b/config/APT_snapshots.d/torproject/serial
index 62fe3da..dd875a1 100644
--- a/config/APT_snapshots.d/torproject/serial
+++ b/config/APT_snapshots.d/torproject/serial
@@ -1 +1 @@
-2017011202
+2017012403
diff --git a/config/base_branch b/config/base_branch
index 038d718..2bf5ad0 100644
--- a/config/base_branch
+++ b/config/base_branch
@@ -1 +1 @@
-testing
+stable
diff --git a/config/binary_rootfs/squashfs.sort b/config/binary_rootfs/squashfs.sort
index 91e42f7..8fbc2a3 100644
--- a/config/binary_rootfs/squashfs.sort
+++ b/config/binary_rootfs/squashfs.sort
@@ -14,4510 +14,4578 @@ usr/lib/locale/zu_ZA.utf8/LC_NUMERIC 32755
usr/lib/locale/zu_ZA.utf8/LC_CTYPE 32754
usr/bin/wc 32753
usr/bin/diff 32752
-usr/bin/head 32751
+bin/touch 32751
lib/i386-linux-gnu/ld-2.19.so 32750
etc/ld.so.cache 32749
lib/i386-linux-gnu/libc-2.19.so 32748
-usr/share/amnesia/readahead-list 32747
-bin/touch 32746
-lib/live/config/0000-readahead 32744
-bin/dash 32743
-bin/grep 32742
-lib/i386-linux-gnu/libpcre.so.3.13.1 32741
-lib/i386-linux-gnu/libdl-2.19.so 32740
-lib/i386-linux-gnu/libpthread-2.19.so 32739
-lib/live/config/0001-sane-clock 32738
-bin/sed 32737
-lib/i386-linux-gnu/libselinux.so.1 32736
-etc/amnesia/version 32735
-bin/date 32734
-lib/live/config/0010-debconf 32732
-lib/live/config/0020-hostname 32731
-etc/hostname 32730
-bin/ip 32729
-usr/bin/mawk 32728
-lib/i386-linux-gnu/libm-2.19.so 32727
-bin/kmod 32726
-lib/modprobe.d/aliases.conf 32725
-etc/modprobe.d/all-net-blacklist.conf 32724
-etc/modprobe.d/amd64-microcode-blacklist.conf 32723
-etc/modprobe.d/fbdev-blacklist.conf 32722
-etc/modprobe.d/intel-microcode-blacklist.conf 32721
-etc/modprobe.d/modesetting.conf 32720
-lib/modules/4.7.0-0.bpo.1-amd64/modules.softdep 32719
-etc/modprobe.d/no-conntrack-helper.conf 32718
-etc/modprobe.d/no-mei.conf 32717
-etc/modprobe.d/no-pc-speaker.conf 32716
-etc/modprobe.d/qxl.conf 32715
-lib/modules/4.7.0-0.bpo.1-amd64/modules.dep.bin 32714
-lib/modules/4.7.0-0.bpo.1-amd64/modules.alias.bin 32713
-lib/modules/4.7.0-0.bpo.1-amd64/modules.symbols.bin 32712
-lib/modules/4.7.0-0.bpo.1-amd64/modules.builtin.bin 32711
-etc/hosts 32709
-bin/cat 32708
-bin/hostname 32706
-lib/i386-linux-gnu/libnsl-2.19.so 32705
-lib/live/config/0030-live-debconfig_passwd 32703
-lib/live/config/0030-user-setup 32702
-usr/bin/debconf-set-selections 32699
-usr/bin/perl 32698
-lib/i386-linux-gnu/libcrypt-2.19.so 32697
-etc/perl/sitecustomize.pl 32696
-usr/share/perl/5.20.2/warnings.pm 32695
-usr/share/perl/5.20.2/strict.pm 32694
-usr/share/perl5/Debconf/Db.pm 32693
-usr/share/perl5/Debconf/Log.pm 32692
-usr/share/perl/5.20.2/base.pm 32691
-usr/share/perl/5.20.2/vars.pm 32690
-usr/share/perl/5.20.2/warnings/register.pm 32689
-usr/share/perl/5.20.2/Exporter.pm 32688
-usr/share/perl5/Debconf/Config.pm 32687
-usr/share/perl5/Debconf/Question.pm 32686
-usr/share/perl5/Debconf/Template.pm 32685
-usr/lib/i386-linux-gnu/perl/5.20.2/POSIX.pm 32684
-usr/lib/i386-linux-gnu/perl/5.20.2/Fcntl.pm 32683
-usr/share/perl/5.20.2/XSLoader.pm 32682
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Fcntl/Fcntl.so 32681
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/POSIX/POSIX.so 32680
-usr/share/perl/5.20.2/Tie/Hash.pm 32679
-usr/share/perl/5.20.2/Carp.pm 32678
-usr/share/perl/5.20.2/Exporter/Heavy.pm 32677
-usr/share/perl/5.20.2/FileHandle.pm 32676
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/File.pm 32675
-usr/share/perl/5.20.2/Symbol.pm 32674
-usr/share/perl/5.20.2/SelectSaver.pm 32673
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Seekable.pm 32672
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Handle.pm 32671
-usr/lib/i386-linux-gnu/perl/5.20.2/IO.pm 32670
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/IO/IO.so 32669
-usr/share/perl5/Debconf/Gettext.pm 32668
-usr/lib/i386-linux-gnu/perl5/5.20/Locale/gettext.pm 32667
-usr/lib/i386-linux-gnu/perl/5.20.2/Encode.pm 32666
-usr/share/perl/5.20.2/constant.pm 32665
-usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Alias.pm 32664
-usr/share/perl/5.20.2/bytes.pm 32663
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Encode/Encode.so 32662
-usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Config.pm 32661
-usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Encoding.pm 32660
-usr/lib/i386-linux-gnu/perl/5.20.2/DynaLoader.pm 32659
-usr/lib/i386-linux-gnu/perl/5.20.2/Config.pm 32658
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Locale/gettext/gettext.so 32657
-usr/share/perl/5.20.2/Text/Wrap.pm 32656
-usr/share/perl/5.20.2/Text/Tabs.pm 32655
-usr/lib/i386-linux-gnu/perl/5.20.2/re.pm 32654
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/re/re.so 32653
-usr/share/perl5/Debconf/Iterator.pm 32652
-usr/share/perl5/Debconf/Base.pm 32651
-usr/share/perl/5.20.2/fields.pm 32650
-usr/share/perl5/Debconf/Encoding.pm 32649
-usr/lib/i386-linux-gnu/perl5/5.20/Text/Iconv.pm 32648
-usr/share/perl/5.20.2/AutoLoader.pm 32647
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Text/Iconv/Iconv.so 32646
-usr/bin/locale 32645
-usr/share/perl5/Text/WrapI18N.pm 32644
-usr/lib/i386-linux-gnu/perl5/5.20/Text/CharWidth.pm 32643
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Text/CharWidth/CharWidth.so 32642
-usr/share/perl/5.20.2/overload.pm 32641
-usr/share/perl/5.20.2/overloading.pm 32640
-usr/share/perl5/Debconf/Priority.pm 32639
-usr/lib/i386-linux-gnu/perl/5.20.2/Hash/Util.pm 32638
-usr/lib/i386-linux-gnu/perl/5.20.2/Scalar/Util.pm 32637
-usr/lib/i386-linux-gnu/perl/5.20.2/List/Util.pm 32636
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/List/Util/Util.so 32635
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Hash/Util/Util.so 32634
-etc/nsswitch.conf 32633
-lib/i386-linux-gnu/libnss_compat-2.19.so 32632
-lib/i386-linux-gnu/libnss_nis-2.19.so 32631
-lib/i386-linux-gnu/libnss_files-2.19.so 32630
-usr/share/perl5/Debconf/DbDriver.pm 32628
-usr/share/perl/5.20.2/Getopt/Long.pm 32627
-etc/debconf.conf 32626
-usr/share/perl5/Debconf/DbDriver/File.pm 32625
-usr/lib/i386-linux-gnu/perl/5.20.2/Cwd.pm 32624
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Cwd/Cwd.so 32623
-usr/share/perl5/Debconf/DbDriver/Cache.pm 32622
-usr/share/perl5/Debconf/Format/822.pm 32621
-usr/share/perl5/Debconf/Format.pm 32620
-usr/share/perl5/Debconf/DbDriver/Stack.pm 32617
-usr/share/perl5/Debconf/DbDriver/Copy.pm 32616
-bin/rm 32611
-usr/lib/user-setup/user-setup-apply 32610
-usr/share/debconf/confmodule 32609
-usr/share/debconf/frontend 32608
-usr/share/perl5/Debconf/AutoSelect.pm 32607
-usr/share/perl5/Debconf/ConfModule.pm 32606
-usr/share/perl/5.20.2/IPC/Open2.pm 32605
-usr/share/perl/5.20.2/IPC/Open3.pm 32604
-usr/share/perl5/Debconf/FrontEnd/Noninteractive.pm 32603
-usr/share/perl5/Debconf/FrontEnd.pm 32602
-usr/lib/user-setup/functions.sh 32601
-sbin/shadowconfig 32600
-usr/sbin/pwck 32599
-usr/sbin/grpck 32598
-etc/login.defs 32596
-usr/sbin/pwconv 32594
-etc/.pwd.lock 32593
-usr/sbin/grpconv 32588
-bin/chown 32575
-bin/chmod 32572
-usr/bin/cut 32569
-usr/bin/dpkg-query 32567
-var/lib/dpkg/arch 32566
-var/lib/dpkg/status 32565
-var/lib/dpkg/triggers/File 32564
-var/lib/dpkg/triggers/Unincorp 32563
-usr/bin/dpkg 32562
-etc/dpkg/dpkg.cfg 32561
-usr/sbin/usermod 32560
-lib/i386-linux-gnu/libaudit.so.1.0.0 32559
-usr/lib/i386-linux-gnu/libsemanage.so.1 32558
-lib/i386-linux-gnu/libsepol.so.1 32557
-lib/i386-linux-gnu/libbz2.so.1.0.4 32556
-usr/lib/i386-linux-gnu/libustr-1.0.so.1.0.4 32555
-usr/sbin/adduser 32542
-usr/share/perl5/Debian/AdduserCommon.pm 32541
-usr/lib/i386-linux-gnu/perl/5.20.2/I18N/Langinfo.pm 32540
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/I18N/Langinfo/Langinfo.so 32539
-etc/adduser.conf 32538
-usr/sbin/groupadd 32537
-usr/sbin/useradd 32531
-etc/default/useradd 32530
-var/log/faillog 32515
-var/log/lastlog 32513
-etc/subuid- 32511
-etc/subgid- 32507
-etc/skel/.config/keepassx/config.ini 32501
-etc/skel/.bash_logout 32500
-etc/skel/.bashrc 32499
-etc/skel/.electrum/config 32498
-etc/skel/.gnome2/accels/.placeholder 32497
-etc/skel/.gnome2/keyrings/default 32496
-etc/skel/.gnome2/keyrings/tails.keyring 32495
-etc/skel/.gnome2_private/.placeholder 32494
-etc/skel/.gnupg/gpg-agent.conf 32493
-etc/skel/.gnupg/gpg.conf 32492
-etc/skel/.icedove/profile.default/chrome/userChrome.css 32491
-etc/skel/.icedove/profile.default/preferences/0000tails.js 32490
-etc/skel/.local/share/applications/mimeapps.list 32489
-etc/skel/.monkeysphere/monkeysphere.conf 32488
-etc/skel/.poedit/config 32487
-etc/skel/.profile 32486
-etc/skel/.purple/accounts.xml 32485
-etc/skel/.purple/blist.xml 32484
-etc/skel/.purple/prefs.xml 32483
-etc/skel/.tor-browser/profile.default/adblockplus/patterns.ini 32482
-etc/skel/.tor-browser/profile.default/bookmarks.html 32481
-etc/skel/.tor-browser/profile.default/chrome/userChrome.css 32480
-etc/skel/.tor-browser/profile.default/localstore.rdf 32479
-etc/skel/.tor-browser/profile.default/preferences/0000tails.js 32478
-etc/skel/.tor-browser/profile.default/preferences/extension-overrides.js 32477
-etc/skel/.xsessionrc 32476
-etc/skel/Desktop/Report_an_error.desktop 32475
-etc/skel/Desktop/tails-documentation.desktop 32474
-usr/bin/chfn 32469
-lib/i386-linux-gnu/libpam.so.0.83.1 32468
-lib/i386-linux-gnu/libpam_misc.so.0.82.0 32467
-etc/pam.d/chfn 32466
-lib/i386-linux-gnu/security/pam_rootok.so 32465
-etc/pam.d/common-auth 32464
-lib/i386-linux-gnu/security/pam_unix.so 32463
-lib/i386-linux-gnu/security/pam_deny.so 32462
-lib/i386-linux-gnu/security/pam_permit.so 32461
-etc/pam.d/common-account 32460
-etc/pam.d/common-session 32459
-lib/i386-linux-gnu/security/pam_systemd.so 32458
-lib/i386-linux-gnu/libcap.so.2.24 32457
-lib/i386-linux-gnu/librt-2.19.so 32456
-lib/i386-linux-gnu/libattr.so.1.1.0 32455
-etc/pam.d/other 32454
-etc/pam.d/common-password 32453
-usr/bin/gpasswd 32446
-lib/live/config/0040-sudo 32400
-lib/live/config/0050-locales 32399
-lib/live/config/0060-locales-all 32398
-lib/live/config/0070-tzdata 32395
-etc/timezone 32394
-usr/sbin/dpkg-reconfigure 32392
-var/lib/dpkg/info/format 32391
-var/lib/dpkg/info/tzdata.templates 32390
-var/lib/dpkg/info/tzdata.config 32389
-usr/share/perl5/Debconf/Element/Noninteractive/Select.pm 32388
-usr/share/perl5/Debconf/Element/Noninteractive.pm 32387
-usr/share/perl5/Debconf/Element.pm 32386
-var/lib/dpkg/info/tzdata.postinst 32385
-bin/cp 32384
-lib/i386-linux-gnu/libacl.so.1.1.0 32383
-usr/share/zoneinfo/UTC 32382
-bin/mv 32379
+lib/live/config/0000-readahead 32746
+bin/dash 32745
+bin/grep 32744
+lib/i386-linux-gnu/libpcre.so.3.13.1 32743
+lib/i386-linux-gnu/libdl-2.19.so 32742
+lib/i386-linux-gnu/libpthread-2.19.so 32741
+lib/live/config/0001-sane-clock 32740
+bin/sed 32739
+lib/i386-linux-gnu/libselinux.so.1 32738
+etc/amnesia/version 32737
+bin/date 32736
+lib/live/config/0010-debconf 32734
+lib/live/config/0020-hostname 32733
+etc/hostname 32732
+bin/ip 32731
+bin/kmod 32730
+lib/modprobe.d/aliases.conf 32729
+etc/modprobe.d/all-net-blacklist.conf 32728
+etc/modprobe.d/amd64-microcode-blacklist.conf 32727
+etc/modprobe.d/fbdev-blacklist.conf 32726
+etc/modprobe.d/intel-microcode-blacklist.conf 32725
+etc/modprobe.d/loop.conf 32724
+etc/modprobe.d/modesetting.conf 32723
+lib/modules/4.8.0-0.bpo.2-amd64/modules.softdep 32722
+etc/modprobe.d/no-conntrack-helper.conf 32721
+etc/modprobe.d/no-mei.conf 32720
+etc/modprobe.d/no-pc-speaker.conf 32719
+etc/modprobe.d/qxl.conf 32718
+lib/modules/4.8.0-0.bpo.2-amd64/modules.dep.bin 32717
+lib/modules/4.8.0-0.bpo.2-amd64/modules.alias.bin 32716
+lib/modules/4.8.0-0.bpo.2-amd64/modules.symbols.bin 32715
+lib/modules/4.8.0-0.bpo.2-amd64/modules.builtin.bin 32714
+usr/bin/mawk 32713
+lib/i386-linux-gnu/libm-2.19.so 32712
+etc/hosts 32710
+bin/cat 32709
+bin/hostname 32707
+lib/i386-linux-gnu/libnsl-2.19.so 32706
+lib/live/config/0030-live-debconfig_passwd 32704
+lib/live/config/0030-user-setup 32703
+usr/bin/debconf-set-selections 32700
+usr/bin/perl 32699
+lib/i386-linux-gnu/libcrypt-2.19.so 32698
+etc/perl/sitecustomize.pl 32697
+usr/share/perl/5.20.2/warnings.pm 32696
+usr/share/perl/5.20.2/strict.pm 32695
+usr/share/perl5/Debconf/Db.pm 32694
+usr/share/perl5/Debconf/Log.pm 32693
+usr/share/perl/5.20.2/base.pm 32692
+usr/share/perl/5.20.2/vars.pm 32691
+usr/share/perl/5.20.2/warnings/register.pm 32690
+usr/share/perl/5.20.2/Exporter.pm 32689
+usr/share/perl5/Debconf/Config.pm 32688
+usr/share/perl5/Debconf/Question.pm 32687
+usr/share/perl5/Debconf/Template.pm 32686
+usr/lib/i386-linux-gnu/perl/5.20.2/POSIX.pm 32685
+usr/lib/i386-linux-gnu/perl/5.20.2/Fcntl.pm 32684
+usr/share/perl/5.20.2/XSLoader.pm 32683
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Fcntl/Fcntl.so 32682
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/POSIX/POSIX.so 32681
+usr/share/perl/5.20.2/Tie/Hash.pm 32680
+usr/share/perl/5.20.2/Carp.pm 32679
+usr/share/perl/5.20.2/Exporter/Heavy.pm 32678
+usr/share/perl/5.20.2/FileHandle.pm 32677
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/File.pm 32676
+usr/share/perl/5.20.2/Symbol.pm 32675
+usr/share/perl/5.20.2/SelectSaver.pm 32674
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Seekable.pm 32673
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Handle.pm 32672
+usr/lib/i386-linux-gnu/perl/5.20.2/IO.pm 32671
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/IO/IO.so 32670
+usr/share/perl5/Debconf/Gettext.pm 32669
+usr/lib/i386-linux-gnu/perl5/5.20/Locale/gettext.pm 32668
+usr/lib/i386-linux-gnu/perl/5.20.2/Encode.pm 32667
+usr/share/perl/5.20.2/constant.pm 32666
+usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Alias.pm 32665
+usr/share/perl/5.20.2/bytes.pm 32664
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Encode/Encode.so 32663
+usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Config.pm 32662
+usr/lib/i386-linux-gnu/perl/5.20.2/Encode/Encoding.pm 32661
+usr/lib/i386-linux-gnu/perl/5.20.2/DynaLoader.pm 32660
+usr/lib/i386-linux-gnu/perl/5.20.2/Config.pm 32659
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Locale/gettext/gettext.so 32658
+usr/share/perl/5.20.2/Text/Wrap.pm 32657
+usr/share/perl/5.20.2/Text/Tabs.pm 32656
+usr/lib/i386-linux-gnu/perl/5.20.2/re.pm 32655
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/re/re.so 32654
+usr/share/perl5/Debconf/Iterator.pm 32653
+usr/share/perl5/Debconf/Base.pm 32652
+usr/share/perl/5.20.2/fields.pm 32651
+usr/share/perl5/Debconf/Encoding.pm 32650
+usr/lib/i386-linux-gnu/perl5/5.20/Text/Iconv.pm 32649
+usr/share/perl/5.20.2/AutoLoader.pm 32648
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Text/Iconv/Iconv.so 32647
+usr/bin/locale 32646
+usr/share/perl5/Text/WrapI18N.pm 32645
+usr/lib/i386-linux-gnu/perl5/5.20/Text/CharWidth.pm 32644
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Text/CharWidth/CharWidth.so 32643
+usr/share/perl/5.20.2/overload.pm 32642
+usr/share/perl/5.20.2/overloading.pm 32641
+usr/share/perl5/Debconf/Priority.pm 32640
+usr/lib/i386-linux-gnu/perl/5.20.2/Hash/Util.pm 32639
+usr/lib/i386-linux-gnu/perl/5.20.2/Scalar/Util.pm 32638
+usr/lib/i386-linux-gnu/perl/5.20.2/List/Util.pm 32637
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/List/Util/Util.so 32636
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Hash/Util/Util.so 32635
+etc/nsswitch.conf 32634
+lib/i386-linux-gnu/libnss_compat-2.19.so 32633
+lib/i386-linux-gnu/libnss_nis-2.19.so 32632
+lib/i386-linux-gnu/libnss_files-2.19.so 32631
+usr/share/perl5/Debconf/DbDriver.pm 32629
+usr/share/perl/5.20.2/Getopt/Long.pm 32628
+etc/debconf.conf 32627
+usr/share/perl5/Debconf/DbDriver/File.pm 32626
+usr/lib/i386-linux-gnu/perl/5.20.2/Cwd.pm 32625
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Cwd/Cwd.so 32624
+usr/share/perl5/Debconf/DbDriver/Cache.pm 32623
+usr/share/perl5/Debconf/Format/822.pm 32622
+usr/share/perl5/Debconf/Format.pm 32621
+usr/share/perl5/Debconf/DbDriver/Stack.pm 32618
+usr/share/perl5/Debconf/DbDriver/Copy.pm 32617
+bin/rm 32612
+usr/lib/user-setup/user-setup-apply 32611
+usr/share/debconf/confmodule 32610
+usr/share/debconf/frontend 32609
+usr/share/perl5/Debconf/AutoSelect.pm 32608
+usr/share/perl5/Debconf/ConfModule.pm 32607
+usr/share/perl/5.20.2/IPC/Open2.pm 32606
+usr/share/perl/5.20.2/IPC/Open3.pm 32605
+usr/share/perl5/Debconf/FrontEnd/Noninteractive.pm 32604
+usr/share/perl5/Debconf/FrontEnd.pm 32603
+usr/lib/user-setup/functions.sh 32602
+sbin/shadowconfig 32601
+usr/sbin/pwck 32600
+usr/sbin/grpck 32599
+etc/login.defs 32597
+usr/sbin/pwconv 32595
+etc/.pwd.lock 32594
+usr/sbin/grpconv 32589
+bin/chown 32576
+bin/chmod 32573
+usr/bin/cut 32570
+usr/bin/dpkg-query 32568
+var/lib/dpkg/arch 32567
+var/lib/dpkg/status 32566
+var/lib/dpkg/triggers/File 32565
+var/lib/dpkg/triggers/Unincorp 32564
+usr/bin/dpkg 32563
+etc/dpkg/dpkg.cfg 32562
+usr/sbin/usermod 32561
+lib/i386-linux-gnu/libaudit.so.1.0.0 32560
+usr/lib/i386-linux-gnu/libsemanage.so.1 32559
+lib/i386-linux-gnu/libsepol.so.1 32558
+lib/i386-linux-gnu/libbz2.so.1.0.4 32557
+usr/lib/i386-linux-gnu/libustr-1.0.so.1.0.4 32556
+usr/sbin/adduser 32543
+usr/share/perl5/Debian/AdduserCommon.pm 32542
+usr/lib/i386-linux-gnu/perl/5.20.2/I18N/Langinfo.pm 32541
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/I18N/Langinfo/Langinfo.so 32540
+etc/adduser.conf 32539
+usr/sbin/groupadd 32538
+usr/sbin/useradd 32532
+etc/default/useradd 32531
+var/log/faillog 32516
+var/log/lastlog 32514
+etc/subuid- 32512
+etc/subgid- 32508
+etc/skel/.config/keepassx/config.ini 32502
+etc/skel/.bash_logout 32501
+etc/skel/.bashrc 32500
+etc/skel/.electrum/config 32499
+etc/skel/.gnome2/accels/.placeholder 32498
+etc/skel/.gnome2/keyrings/default 32497
+etc/skel/.gnome2/keyrings/tails.keyring 32496
+etc/skel/.gnome2_private/.placeholder 32495
+etc/skel/.gnupg/gpg-agent.conf 32494
+etc/skel/.gnupg/gpg.conf 32493
+etc/skel/.icedove/profile.default/chrome/userChrome.css 32492
+etc/skel/.icedove/profile.default/preferences/0000tails.js 32491
+etc/skel/.local/share/applications/mimeapps.list 32490
+etc/skel/.monkeysphere/monkeysphere.conf 32489
+etc/skel/.poedit/config 32488
+etc/skel/.profile 32487
+etc/skel/.purple/accounts.xml 32486
+etc/skel/.purple/blist.xml 32485
+etc/skel/.purple/prefs.xml 32484
+etc/skel/.tor-browser/profile.default/bookmarks.html 32483
+etc/skel/.tor-browser/profile.default/chrome/userChrome.css 32482
+etc/skel/.tor-browser/profile.default/extension-data/ublock0.sqlite 32481
+etc/skel/.tor-browser/profile.default/preferences/0000tails.js 32480
+etc/skel/.tor-browser/profile.default/preferences/extension-overrides.js 32479
+etc/skel/.xsessionrc 32478
+etc/skel/Desktop/Report_an_error.desktop 32477
+etc/skel/Desktop/tails-documentation.desktop 32476
+usr/bin/chfn 32471
+lib/i386-linux-gnu/libpam.so.0.83.1 32470
+lib/i386-linux-gnu/libpam_misc.so.0.82.0 32469
+etc/pam.d/chfn 32468
+lib/i386-linux-gnu/security/pam_rootok.so 32467
+etc/pam.d/common-auth 32466
+lib/i386-linux-gnu/security/pam_unix.so 32465
+lib/i386-linux-gnu/security/pam_deny.so 32464
+lib/i386-linux-gnu/security/pam_permit.so 32463
+etc/pam.d/common-account 32462
+etc/pam.d/common-session 32461
+lib/i386-linux-gnu/security/pam_systemd.so 32460
+lib/i386-linux-gnu/libcap.so.2.24 32459
+lib/i386-linux-gnu/librt-2.19.so 32458
+lib/i386-linux-gnu/libattr.so.1.1.0 32457
+etc/pam.d/other 32456
+etc/pam.d/common-password 32455
+usr/bin/gpasswd 32448
+lib/live/config/0040-sudo 32402
+lib/live/config/0050-locales 32401
+lib/live/config/0060-locales-all 32400
+lib/live/config/0070-tzdata 32397
+etc/timezone 32396
+usr/sbin/dpkg-reconfigure 32394
+var/lib/dpkg/info/format 32393
+var/lib/dpkg/info/tzdata.templates 32392
+var/lib/dpkg/info/tzdata.config 32391
+usr/bin/head 32390
+usr/share/perl5/Debconf/Element/Noninteractive/Select.pm 32389
+usr/share/perl5/Debconf/Element/Noninteractive.pm 32388
+usr/share/perl5/Debconf/Element.pm 32387
+var/lib/dpkg/info/tzdata.postinst 32386
+bin/cp 32385
+lib/i386-linux-gnu/libacl.so.1.1.0 32384
+usr/share/zoneinfo/UTC 32383
+bin/mv 32380
bin/which 32378
-lib/live/config/0090-kdm 32375
-lib/live/config/0150-keyboard-configuration 32374
-lib/live/config/1000-remount-procfs 32373
-bin/mount 32372
-lib/i386-linux-gnu/libmount.so.1.1.0 32371
-lib/i386-linux-gnu/libblkid.so.1.1.0 32370
-lib/i386-linux-gnu/libuuid.so.1.3.0 32369
-lib/live/mount/overlay/etc/fstab 32368
-etc/fstab 32367
-lib/live/config/1020-gnome-panel-data 32358
-usr/bin/sudo 32357
-lib/i386-linux-gnu/libutil-2.19.so 32356
-usr/lib/sudo/sudoers.so 32355
-etc/default/nss 32354
-etc/sudoers 32353
-etc/sudoers.d/README 32352
-etc/sudoers.d/always-ask-password 32351
-etc/sudoers.d/tails-greeter-cryptsetup 32350
-etc/sudoers.d/tails-greeter-live-persist 32349
-etc/sudoers.d/zzz_boot_profile 32348
-etc/sudoers.d/zzz_halt 32347
-etc/sudoers.d/zzz_onioncircuits 32346
-etc/sudoers.d/zzz_persistence-setup 32345
-etc/sudoers.d/zzz_tails-debugging-info 32344
-etc/sudoers.d/zzz_unsafe-browser 32343
-etc/sudoers.d/zzz_upgrade 32342
-etc/host.conf 32341
-etc/resolv.conf 32340
-etc/pam.d/sudo 32339
-etc/pam.d/common-session-noninteractive 32338
-usr/bin/gconftool-2 32337
-usr/lib/i386-linux-gnu/libgconf-2.so.4.1.5 32336
-usr/lib/i386-linux-gnu/libgthread-2.0.so.0.4200.1 32335
-lib/i386-linux-gnu/libglib-2.0.so.0.4200.1 32334
-usr/lib/i386-linux-gnu/libxml2.so.2.9.1 32333
-usr/lib/i386-linux-gnu/libgio-2.0.so.0.4200.1 32332
-usr/lib/i386-linux-gnu/libgmodule-2.0.so.0.4200.1 32331
-usr/lib/i386-linux-gnu/libdbus-glib-1.so.2.2.2 32330
-lib/i386-linux-gnu/libdbus-1.so.3.8.13 32329
-usr/lib/i386-linux-gnu/libgobject-2.0.so.0.4200.1 32328
-lib/i386-linux-gnu/libz.so.1.2.8 32327
-lib/i386-linux-gnu/liblzma.so.5.0.0 32326
-lib/i386-linux-gnu/libresolv-2.19.so 32325
-usr/lib/i386-linux-gnu/libffi.so.6.0.2 32324
-etc/gconf/2/path 32323
-usr/lib/i386-linux-gnu/gconf/2/libgconfbackend-xml.so 32322
-etc/gconf/gconf.xml.mandatory/%gconf-tree.xml 32321
-lib/live/config/1030-gnome-power-manager 32319
-lib/live/config/1040-gnome-screensaver 32317
-usr/bin/dbus-launch 32316
-usr/lib/i386-linux-gnu/libX11.so.6.3.0 32315
-usr/lib/i386-linux-gnu/libxcb.so.1.1.0 32314
-usr/lib/i386-linux-gnu/libXau.so.6.0.0 32313
-usr/lib/i386-linux-gnu/libXdmcp.so.6.0.0 32312
-usr/bin/dbus-daemon 32311
-lib/i386-linux-gnu/libsystemd.so.0.3.1 32310
-lib/i386-linux-gnu/libexpat.so.1.6.0 32309
-usr/lib/i386-linux-gnu/libcap-ng.so.0.0.0 32308
-lib/i386-linux-gnu/libgcrypt.so.20.0.3 32307
-lib/i386-linux-gnu/libgpg-error.so.0.13.0 32306
-etc/dbus-1/session.conf 32305
-usr/share/dbus-1/services/ca.desrt.dconf-editor.service 32304
-usr/share/dbus-1/services/ca.desrt.dconf.service 32303
-usr/share/dbus-1/services/gvfs-daemon.service 32302
-usr/share/dbus-1/services/gvfs-metadata.service 32301
-usr/share/dbus-1/services/org.a11y.Bus.service 32300
-usr/share/dbus-1/services/org.a11y.atspi.Registry.service 32299
-usr/share/dbus-1/services/org.fedoraproject.Config.Printing.service 32298
-usr/share/dbus-1/services/org.freedesktop.ColorHelper.service 32297
-usr/share/dbus-1/services/org.freedesktop.FileManager1.service 32296
-usr/share/dbus-1/services/org.freedesktop.Telepathy.AccountManager.service 32295
-usr/share/dbus-1/services/org.freedesktop.Telepathy.MissionControl5.service 32294
-usr/share/dbus-1/services/org.freedesktop.secrets.service 32293
-usr/share/dbus-1/system-services/org.freedesktop.systemd1.service 32292
-usr/share/dbus-1/services/org.gnome.Calculator.SearchProvider.service 32291
-usr/share/dbus-1/services/org.gnome.ControlCenter.SearchProvider.service 32290
-usr/share/dbus-1/services/org.gnome.ControlCenter.service 32289
-usr/share/dbus-1/services/org.gnome.FileRoller.ArchiveManager1.service 32288
-usr/share/dbus-1/services/org.gnome.FileRoller.service 32287
-usr/share/dbus-1/services/org.gnome.GConf.service 32286
-usr/share/dbus-1/services/org.gnome.Nautilus.service 32285
-usr/share/dbus-1/services/org.gnome.Screenshot.service 32284
-usr/share/dbus-1/services/org.gnome.Shell.CalendarServer.service 32283
-usr/share/dbus-1/services/org.gnome.Shell.HotplugSniffer.service 32282
-usr/share/dbus-1/services/org.gnome.Shell.PortalHelper.service 32281
-usr/share/dbus-1/services/org.gnome.Terminal.service 32280
-usr/share/dbus-1/services/org.gnome.Totem.service 32279
-usr/share/dbus-1/services/org.gnome.evince.Daemon.service 32278
-usr/share/dbus-1/services/org.gnome.evolution.dataserver.AddressBook.service 32277
-usr/share/dbus-1/services/org.gnome.evolution.dataserver.Calendar.service 32276
-usr/share/dbus-1/services/org.gnome.evolution.dataserver.Sources.service 32275
-usr/share/dbus-1/services/org.gnome.evolution.dataserver.UserPrompter.service 32274
-usr/share/dbus-1/services/org.gnome.gedit.service 32273
-usr/share/dbus-1/services/org.gnome.keyring.PrivatePrompter.service 32272
-usr/share/dbus-1/services/org.gnome.keyring.SystemPrompter.service 32271
-usr/share/dbus-1/services/org.gnome.keyring.service 32270
-usr/share/dbus-1/services/org.gnome.seahorse.Application.service 32269
-usr/share/dbus-1/services/org.gnome.seahorse.service 32268
-usr/share/dbus-1/services/org.gtk.GLib.PACRunner.service 32267
-usr/share/dbus-1/services/org.gtk.Private.AfcVolumeMonitor.service 32266
-usr/share/dbus-1/services/org.gtk.Private.GPhoto2VolumeMonitor.service 32265
-usr/share/dbus-1/services/org.gtk.Private.GoaVolumeMonitor.service 32264
-usr/share/dbus-1/services/org.gtk.Private.MTPVolumeMonitor.service 32263
-usr/share/dbus-1/services/org.gtk.Private.UDisks2VolumeMonitor.service 32262
-usr/bin/gsettings 32261
-usr/share/glib-2.0/schemas/gschemas.compiled 32260
-usr/lib/i386-linux-gnu/gio/modules/giomodule.cache 32259
-usr/lib/i386-linux-gnu/gio/modules/libdconfsettings.so 32258
-etc/dconf/profile/user 32257
-etc/dconf/db/local 32256
-lib/live/config/1050-kaboom 32254
-lib/live/config/1060-kde-services 32253
-lib/live/config/1070-debian-installer-launcher 32252
-lib/live/config/1080-policykit 32251
-lib/live/config/1090-ssl-cert 32250
-usr/sbin/make-ssl-cert 32249
-bin/bash 32248
-lib/i386-linux-gnu/libncurses.so.5.9 32247
-lib/i386-linux-gnu/libtinfo.so.5.9 32246
-bin/mktemp 32245
-usr/share/ssl-cert/ssleay.cnf 32242
-usr/bin/openssl 32241
-usr/lib/i386-linux-gnu/i686/cmov/libssl.so.1.0.0 32240
-usr/lib/i386-linux-gnu/i686/cmov/libcrypto.so.1.0.0 32239
-etc/ssl/openssl.cnf 32238
-bin/ln 32235
-lib/live/config/1110-anacron 32233
-lib/live/config/1120-util-linux 32232
-lib/live/config/1130-login 32230
-lib/live/config/1140-xserver-xorg 32226
-usr/bin/tr 32225
-usr/bin/lspci 32224
-lib/i386-linux-gnu/libpci.so.3.2.1 32223
-bin/ls 32222
-usr/share/live/config/xserver-xorg/qxl.ids 32221
-usr/bin/basename 32220
-bin/mkdir 32219
-usr/share/live/config/xserver-xorg/qxl.conf 32218
-usr/bin/update-alternatives 32217
-lib/live/config/1160-openssh-server 32216
-lib/live/config/1170-xfce4-panel 32215
-lib/live/config/1180-xscreensaver 32214
-lib/live/config/1190-broadcom-sta 32213
-lib/live/config/1500-reconfigure-APT 32212
-lib/live/config/1600-undivert-APT 32190
-usr/bin/dpkg-divert 32189
-usr/bin/apt-get.real 32185
-lib/live/config/2000-aesthetics 32183
-lib/live/config/2000-import-gnupg-key 32182
-usr/bin/gpg 32181
-lib/i386-linux-gnu/libreadline.so.6.3 32180
-lib/i386-linux-gnu/libusb-0.1.so.4.4.4 32179
-usr/share/doc/tails/website/tails-accounting.key 32178
-usr/share/doc/tails/website/tails-bugs.key 32177
-usr/share/doc/tails/website/tails-email.key 32176
-usr/share/doc/tails/website/tails-mirrors.key 32175
-usr/share/doc/tails/website/tails-press.key 32174
-usr/share/doc/tails/website/tails-signing.key 32173
-usr/share/doc/tails/website/tails-sysadmins.key 32172
-lib/live/config/2010-pidgin 32170
-usr/local/bin/lc.py 32169
-usr/bin/python2.7 32168
-usr/lib/python2.7/site.py 32167
-usr/lib/python2.7/os.py 32165
-usr/lib/python2.7/posixpath.py 32163
-usr/lib/python2.7/stat.py 32161
-usr/lib/python2.7/genericpath.py 32159
-usr/lib/python2.7/warnings.py 32157
-usr/lib/python2.7/linecache.py 32155
-usr/lib/python2.7/types.py 32153
-usr/lib/python2.7/UserDict.py 32151
-usr/lib/python2.7/_abcoll.py 32149
-usr/lib/python2.7/abc.py 32147
-usr/lib/python2.7/_weakrefset.py 32145
-usr/lib/python2.7/copy_reg.py 32143
-usr/lib/python2.7/traceback.py 32141
-usr/lib/python2.7/sysconfig.py 32139
-usr/lib/python2.7/re.py 32137
-usr/lib/python2.7/sre_compile.py 32135
-usr/lib/python2.7/sre_parse.py 32133
-usr/lib/python2.7/sre_constants.py 32131
-usr/lib/python2.7/_sysconfigdata.py 32129
-usr/lib/python2.7/plat-i386-linux-gnu/_sysconfigdata_nd.py 32127
-usr/lib/python2.7/dist-packages/PILcompat.pth 32125
-usr/share/pyshared/gtk-2.0-pysupport-compat.pth 32124
-usr/lib/python2.7/dist-packages/matplotlib-1.4.2-nspkg.pth 32123
-usr/share/pyshared/pygtk.pth 32122
-usr/lib/pymodules/python2.7/.path 32121
-etc/python2.7/sitecustomize.py 32120
-usr/lib/python2.7/encodings/__init__.py 32118
-usr/lib/python2.7/codecs.py 32116
-usr/lib/python2.7/encodings/aliases.py 32114
-usr/lib/python2.7/encodings/utf_8.py 32112
-usr/lib/python2.7/__future__.py 32110
-usr/lib/python2.7/optparse.py 32108
-usr/lib/python2.7/textwrap.py 32106
-usr/lib/python2.7/string.py 32104
-usr/lib/python2.7/gettext.py 32102
-usr/lib/python2.7/locale.py 32100
-usr/lib/python2.7/functools.py 32098
-usr/lib/python2.7/copy.py 32096
-usr/lib/python2.7/weakref.py 32094
-usr/lib/python2.7/struct.py 32092
-usr/lib/python2.7/random.py 32090
-usr/lib/python2.7/hashlib.py 32088
-usr/lib/python2.7/lib-dynload/_hashlib.i386-linux-gnu.so 32086
-usr/share/amnesia/firstnames.txt 32085
-usr/bin/od 32084
-usr/bin/expr 32083
-usr/bin/bc 32082
-lib/live/config/2060-create-upgrader-run-directory 32080
-usr/bin/install 32079
-lib/live/config/2080-install-i2p 32078
-usr/local/lib/tails-shell-library/i2p.sh 32077
-usr/local/lib/tails-shell-library/common.sh 32076
-usr/local/lib/tails-shell-library/localization.sh 32075
-lib/live/config/7000-debug 32074
-lib/live/config/8000-rootpw 32073
-lib/live/config/9980-permissions 32072
-bin/udevadm 32071
-lib/i386-linux-gnu/libkmod.so.2.2.8 32070
-etc/udev/udev.conf 32069
-bin/readlink 32068
-lib/live/config/9990-hooks 32065
-lib/systemd/systemd-udevd 32064
-lib/udev/hwdb.bin 32063
-etc/init.d/keyboard-setup 32062
-etc/default/locale 32061
-lib/lsb/init-functions 32060
-lib/systemd/network/99-default.link 32059
-etc/udev/rules.d/00-mac-spoof.rules 32058
-lib/udev/rules.d/40-usb_modeswitch.rules 32057
-lib/udev/rules.d/42-usb-hid-pm.rules 32056
-lib/udev/rules.d/50-firmware.rules 32055
-lib/udev/rules.d/50-udev-default.rules 32054
-bin/run-parts 32053
-lib/udev/rules.d/55-dm.rules 32052
-lib/udev/rules.d/56-hpmud.rules 32051
-lib/udev/rules.d/56-lvm.rules 32050
-lib/udev/rules.d/60-cdrom_id.rules 32049
-lib/udev/rules.d/60-crda.rules 32048
-lib/udev/rules.d/60-drm.rules 32047
-lib/udev/rules.d/60-ekeyd.rules 32046
-lib/udev/rules.d/60-fuse.rules 32045
-lib/udev/rules.d/60-gnupg.rules 32044
-lib/udev/rules.d/60-gobi-loader.rules 32043
-lib/udev/rules.d/60-keyboard.rules 32042
-lib/udev/rules.d/60-libgphoto2-6.rules 32041
-lib/lsb/init-functions.d/20-left-info-blocks 32040
-lib/lsb/init-functions.d/40-systemd 32039
-lib/lsb/init-functions.d/99-plymouth 32038
-bin/plymouth 32037
-lib/udev/rules.d/60-libsane.rules 32036
+lib/live/config/0090-kdm 32376
+lib/live/config/0150-keyboard-configuration 32375
+lib/live/config/1000-remount-procfs 32374
+bin/mount 32373
+lib/i386-linux-gnu/libmount.so.1.1.0 32372
+lib/i386-linux-gnu/libblkid.so.1.1.0 32371
+lib/i386-linux-gnu/libuuid.so.1.3.0 32370
+lib/live/mount/overlay/etc/fstab 32369
+etc/fstab 32368
+lib/live/config/1020-gnome-panel-data 32359
+usr/bin/sudo 32358
+lib/i386-linux-gnu/libutil-2.19.so 32357
+usr/lib/sudo/sudoers.so 32356
+etc/default/nss 32355
+etc/sudoers 32354
+etc/sudoers.d/README 32353
+etc/sudoers.d/always-ask-password 32352
+etc/sudoers.d/tails-greeter-cryptsetup 32351
+etc/sudoers.d/tails-greeter-live-persist 32350
+etc/sudoers.d/zzz_boot_profile 32349
+etc/sudoers.d/zzz_halt 32348
+etc/sudoers.d/zzz_persistence-setup 32347
+etc/sudoers.d/zzz_tails-debugging-info 32346
+etc/sudoers.d/zzz_unsafe-browser 32345
+etc/sudoers.d/zzz_upgrade 32344
+etc/host.conf 32343
+etc/resolv.conf 32342
+etc/pam.d/sudo 32341
+etc/pam.d/common-session-noninteractive 32340
+usr/bin/gconftool-2 32339
+usr/lib/i386-linux-gnu/libgconf-2.so.4.1.5 32338
+usr/lib/i386-linux-gnu/libgthread-2.0.so.0.4200.1 32337
+lib/i386-linux-gnu/libglib-2.0.so.0.4200.1 32336
+usr/lib/i386-linux-gnu/libxml2.so.2.9.1 32335
+usr/lib/i386-linux-gnu/libgio-2.0.so.0.4200.1 32334
+usr/lib/i386-linux-gnu/libgmodule-2.0.so.0.4200.1 32333
+usr/lib/i386-linux-gnu/libdbus-glib-1.so.2.2.2 32332
+lib/i386-linux-gnu/libdbus-1.so.3.8.14 32331
+usr/lib/i386-linux-gnu/libgobject-2.0.so.0.4200.1 32330
+lib/i386-linux-gnu/libz.so.1.2.8 32329
+lib/i386-linux-gnu/liblzma.so.5.0.0 32328
+lib/i386-linux-gnu/libresolv-2.19.so 32327
+usr/lib/i386-linux-gnu/libffi.so.6.0.2 32326
+etc/gconf/2/path 32325
+usr/lib/i386-linux-gnu/gconf/2/libgconfbackend-xml.so 32324
+etc/gconf/gconf.xml.mandatory/%gconf-tree.xml 32323
+lib/live/config/1030-gnome-power-manager 32321
+lib/live/config/1040-gnome-screensaver 32319
+usr/bin/dbus-launch 32318
+usr/lib/i386-linux-gnu/libX11.so.6.3.0 32317
+usr/lib/i386-linux-gnu/libxcb.so.1.1.0 32316
+usr/lib/i386-linux-gnu/libXau.so.6.0.0 32315
+usr/lib/i386-linux-gnu/libXdmcp.so.6.0.0 32314
+usr/bin/dbus-daemon 32313
+lib/i386-linux-gnu/libsystemd.so.0.3.1 32312
+lib/i386-linux-gnu/libexpat.so.1.6.0 32311
+usr/lib/i386-linux-gnu/libcap-ng.so.0.0.0 32310
+lib/i386-linux-gnu/libgcrypt.so.20.0.3 32309
+lib/i386-linux-gnu/libgpg-error.so.0.13.0 32308
+etc/dbus-1/session.conf 32307
+usr/share/dbus-1/services/ca.desrt.dconf-editor.service 32306
+usr/share/dbus-1/services/ca.desrt.dconf.service 32305
+usr/share/dbus-1/services/gvfs-daemon.service 32304
+usr/share/dbus-1/services/gvfs-metadata.service 32303
+usr/share/dbus-1/services/org.a11y.Bus.service 32302
+usr/share/dbus-1/services/org.a11y.atspi.Registry.service 32301
+usr/share/dbus-1/services/org.fedoraproject.Config.Printing.service 32300
+usr/share/dbus-1/services/org.freedesktop.ColorHelper.service 32299
+usr/share/dbus-1/services/org.freedesktop.FileManager1.service 32298
+usr/share/dbus-1/services/org.freedesktop.Telepathy.AccountManager.service 32297
+usr/share/dbus-1/services/org.freedesktop.Telepathy.MissionControl5.service 32296
+usr/share/dbus-1/services/org.freedesktop.secrets.service 32295
+usr/share/dbus-1/system-services/org.freedesktop.systemd1.service 32294
+usr/share/dbus-1/services/org.gnome.Calculator.SearchProvider.service 32293
+usr/share/dbus-1/services/org.gnome.ControlCenter.SearchProvider.service 32292
+usr/share/dbus-1/services/org.gnome.ControlCenter.service 32291
+usr/share/dbus-1/services/org.gnome.FileRoller.ArchiveManager1.service 32290
+usr/share/dbus-1/services/org.gnome.FileRoller.service 32289
+usr/share/dbus-1/services/org.gnome.GConf.service 32288
+usr/share/dbus-1/services/org.gnome.Nautilus.service 32287
+usr/share/dbus-1/services/org.gnome.Screenshot.service 32286
+usr/share/dbus-1/services/org.gnome.Shell.CalendarServer.service 32285
+usr/share/dbus-1/services/org.gnome.Shell.HotplugSniffer.service 32284
+usr/share/dbus-1/services/org.gnome.Shell.PortalHelper.service 32283
+usr/share/dbus-1/services/org.gnome.Terminal.service 32282
+usr/share/dbus-1/services/org.gnome.Totem.service 32281
+usr/share/dbus-1/services/org.gnome.evince.Daemon.service 32280
+usr/share/dbus-1/services/org.gnome.evolution.dataserver.AddressBook.service 32279
+usr/share/dbus-1/services/org.gnome.evolution.dataserver.Calendar.service 32278
+usr/share/dbus-1/services/org.gnome.evolution.dataserver.Sources.service 32277
+usr/share/dbus-1/services/org.gnome.evolution.dataserver.UserPrompter.service 32276
+usr/share/dbus-1/services/org.gnome.gedit.service 32275
+usr/share/dbus-1/services/org.gnome.keyring.PrivatePrompter.service 32274
+usr/share/dbus-1/services/org.gnome.keyring.SystemPrompter.service 32273
+usr/share/dbus-1/services/org.gnome.keyring.service 32272
+usr/share/dbus-1/services/org.gnome.seahorse.Application.service 32271
+usr/share/dbus-1/services/org.gnome.seahorse.service 32270
+usr/share/dbus-1/services/org.gtk.GLib.PACRunner.service 32269
+usr/share/dbus-1/services/org.gtk.Private.AfcVolumeMonitor.service 32268
+usr/share/dbus-1/services/org.gtk.Private.GPhoto2VolumeMonitor.service 32267
+usr/share/dbus-1/services/org.gtk.Private.GoaVolumeMonitor.service 32266
+usr/share/dbus-1/services/org.gtk.Private.MTPVolumeMonitor.service 32265
+usr/share/dbus-1/services/org.gtk.Private.UDisks2VolumeMonitor.service 32264
+usr/bin/gsettings 32263
+usr/share/glib-2.0/schemas/gschemas.compiled 32262
+usr/lib/i386-linux-gnu/gio/modules/giomodule.cache 32261
+usr/lib/i386-linux-gnu/gio/modules/libdconfsettings.so 32260
+etc/dconf/profile/user 32259
+etc/dconf/db/local 32258
+lib/live/config/1050-kaboom 32256
+lib/live/config/1060-kde-services 32255
+lib/live/config/1070-debian-installer-launcher 32254
+lib/live/config/1080-policykit 32253
+lib/live/config/1090-ssl-cert 32252
+usr/sbin/make-ssl-cert 32251
+bin/bash 32250
+lib/i386-linux-gnu/libncurses.so.5.9 32249
+lib/i386-linux-gnu/libtinfo.so.5.9 32248
+bin/mktemp 32247
+usr/share/ssl-cert/ssleay.cnf 32244
+usr/bin/openssl 32243
+usr/lib/i386-linux-gnu/i686/cmov/libssl.so.1.0.0 32242
+usr/lib/i386-linux-gnu/i686/cmov/libcrypto.so.1.0.0 32241
+etc/ssl/openssl.cnf 32240
+bin/ln 32237
+lib/live/config/1110-anacron 32235
+lib/live/config/1120-util-linux 32234
+lib/live/config/1130-login 32232
+lib/live/config/1140-xserver-xorg 32228
+usr/bin/tr 32227
+usr/bin/lspci 32226
+lib/i386-linux-gnu/libpci.so.3.2.1 32225
+bin/ls 32224
+usr/share/live/config/xserver-xorg/qxl.ids 32223
+usr/bin/basename 32222
+bin/mkdir 32221
+usr/share/live/config/xserver-xorg/qxl.conf 32220
+usr/bin/update-alternatives 32219
+lib/live/config/1160-openssh-server 32218
+lib/live/config/1170-xfce4-panel 32217
+lib/live/config/1180-xscreensaver 32216
+lib/live/config/1190-broadcom-sta 32215
+lib/live/config/1500-reconfigure-APT 32214
+lib/live/config/1600-undivert-APT 32189
+usr/bin/dpkg-divert 32188
+usr/bin/apt-get.real 32184
+lib/live/config/2000-aesthetics 32182
+lib/live/config/2000-import-gnupg-key 32181
+usr/bin/gpg 32180
+lib/i386-linux-gnu/libreadline.so.6.3 32179
+lib/i386-linux-gnu/libusb-0.1.so.4.4.4 32178
+usr/share/doc/tails/website/tails-accounting.key 32177
+usr/share/doc/tails/website/tails-bugs.key 32176
+usr/share/doc/tails/website/tails-email.key 32175
+usr/share/doc/tails/website/tails-mirrors.key 32174
+usr/share/doc/tails/website/tails-press.key 32173
+usr/share/doc/tails/website/tails-signing.key 32172
+usr/share/doc/tails/website/tails-sysadmins.key 32171
+lib/live/config/2010-pidgin 32169
+usr/local/bin/lc.py 32168
+usr/bin/python2.7 32167
+usr/lib/python2.7/site.py 32166
+usr/lib/python2.7/os.py 32164
+usr/lib/python2.7/posixpath.py 32162
+usr/lib/python2.7/stat.py 32160
+usr/lib/python2.7/genericpath.py 32158
+usr/lib/python2.7/warnings.py 32156
+usr/lib/python2.7/linecache.py 32154
+usr/lib/python2.7/types.py 32152
+usr/lib/python2.7/UserDict.py 32150
+usr/lib/python2.7/_abcoll.py 32148
+usr/lib/python2.7/abc.py 32146
+usr/lib/python2.7/_weakrefset.py 32144
+usr/lib/python2.7/copy_reg.py 32142
+usr/lib/python2.7/traceback.py 32140
+usr/lib/python2.7/sysconfig.py 32138
+usr/lib/python2.7/re.py 32136
+usr/lib/python2.7/sre_compile.py 32134
+usr/lib/python2.7/sre_parse.py 32132
+usr/lib/python2.7/sre_constants.py 32130
+usr/lib/python2.7/_sysconfigdata.py 32128
+usr/lib/python2.7/plat-i386-linux-gnu/_sysconfigdata_nd.py 32126
+usr/lib/python2.7/dist-packages/PILcompat.pth 32124
+usr/share/pyshared/gtk-2.0-pysupport-compat.pth 32123
+usr/lib/python2.7/dist-packages/matplotlib-1.4.2-nspkg.pth 32122
+usr/share/pyshared/pygtk.pth 32121
+usr/lib/pymodules/python2.7/.path 32120
+etc/python2.7/sitecustomize.py 32119
+usr/lib/python2.7/encodings/__init__.py 32117
+usr/lib/python2.7/codecs.py 32115
+usr/lib/python2.7/encodings/aliases.py 32113
+usr/lib/python2.7/encodings/utf_8.py 32111
+usr/lib/python2.7/__future__.py 32109
+usr/lib/python2.7/optparse.py 32107
+usr/lib/python2.7/textwrap.py 32105
+usr/lib/python2.7/string.py 32103
+usr/lib/python2.7/gettext.py 32101
+usr/lib/python2.7/locale.py 32099
+usr/lib/python2.7/functools.py 32097
+usr/lib/python2.7/copy.py 32095
+usr/lib/python2.7/weakref.py 32093
+usr/lib/python2.7/struct.py 32091
+usr/lib/python2.7/random.py 32089
+usr/lib/python2.7/hashlib.py 32087
+usr/lib/python2.7/lib-dynload/_hashlib.i386-linux-gnu.so 32085
+usr/share/amnesia/firstnames.txt 32084
+usr/bin/od 32083
+usr/bin/expr 32082
+usr/bin/bc 32081
+lib/live/config/2060-create-upgrader-run-directory 32079
+usr/bin/install 32078
+lib/live/config/2080-install-i2p 32077
+usr/local/lib/tails-shell-library/i2p.sh 32076
+usr/local/lib/tails-shell-library/common.sh 32075
+usr/local/lib/tails-shell-library/localization.sh 32074
+lib/live/config/7000-debug 32073
+lib/live/config/8000-rootpw 32072
+lib/live/config/9980-permissions 32071
+bin/udevadm 32070
+lib/i386-linux-gnu/libkmod.so.2.2.8 32069
+etc/udev/udev.conf 32068
+bin/readlink 32067
+lib/live/config/9990-hooks 32064
+lib/systemd/systemd-udevd 32063
+lib/udev/hwdb.bin 32062
+lib/systemd/network/99-default.link 32061
+etc/udev/rules.d/00-mac-spoof.rules 32060
+lib/udev/rules.d/40-usb_modeswitch.rules 32059
+lib/udev/rules.d/42-usb-hid-pm.rules 32058
+lib/udev/rules.d/50-firmware.rules 32057
+lib/udev/rules.d/50-udev-default.rules 32056
+lib/udev/rules.d/55-dm.rules 32055
+lib/udev/rules.d/56-hpmud.rules 32054
+lib/udev/rules.d/56-lvm.rules 32053
+lib/udev/rules.d/60-cdrom_id.rules 32052
+lib/udev/rules.d/60-crda.rules 32051
+lib/udev/rules.d/60-drm.rules 32050
+lib/udev/rules.d/60-ekeyd.rules 32049
+lib/udev/rules.d/60-fuse.rules 32048
+etc/init.d/keyboard-setup 32047
+lib/udev/rules.d/60-gnupg.rules 32046
+lib/udev/rules.d/60-gobi-loader.rules 32045
+lib/udev/rules.d/60-keyboard.rules 32044
+lib/udev/rules.d/60-libgphoto2-6.rules 32043
+etc/default/locale 32042
+lib/lsb/init-functions 32041
+bin/run-parts 32040
+lib/lsb/init-functions.d/20-left-info-blocks 32039
+lib/lsb/init-functions.d/40-systemd 32038
+lib/lsb/init-functions.d/99-plymouth 32037
+bin/plymouth 32036
lib/i386-linux-gnu/libply.so.2.1.0 32035
-lib/udev/rules.d/60-open-vm-tools.rules 32034
-lib/udev/rules.d/60-persistent-alsa.rules 32033
-lib/udev/rules.d/60-persistent-input.rules 32032
-lib/udev/rules.d/60-persistent-serial.rules 32031
-lib/udev/rules.d/60-persistent-storage-dm.rules 32030
-lib/udev/rules.d/60-persistent-storage-tape.rules 32029
-lib/udev/rules.d/60-persistent-storage.rules 32028
-lib/udev/rules.d/60-persistent-v4l.rules 32027
-etc/udev/rules.d/60-virtualbox-guest-dkms.rules 32026
-lib/udev/rules.d/61-accelerometer.rules 32025
-lib/udev/rules.d/61-gnome-settings-daemon-rfkill.rules 32024
-lib/udev/rules.d/64-btrfs.rules 32023
-lib/udev/rules.d/64-xorg-xkb.rules 32022
-lib/udev/rules.d/66-bilibop.rules 32021
-lib/udev/rules.d/69-cd-sensors.rules 32020
-lib/udev/rules.d/69-libmtp.rules 32019
-lib/udev/rules.d/69-lvm-metad.rules 32018
-lib/udev/rules.d/69-xorg-vmmouse.rules 32017
-lib/udev/rules.d/70-power-switch.rules 32016
-etc/udev/rules.d/70-protect-boot-medium-for-udisks.rules 32015
-lib/udev/rules.d/70-uaccess.rules 32014
-lib/udev/rules.d/71-seat.rules 32013
-lib/udev/rules.d/73-idrac.rules 32012
-lib/udev/rules.d/73-seat-late.rules 32011
-lib/udev/rules.d/75-net-description.rules 32010
-lib/udev/rules.d/75-probe_mtd.rules 32009
-lib/udev/rules.d/75-tty-description.rules 32008
-lib/udev/rules.d/77-mm-cinterion-port-types.rules 32007
-lib/udev/rules.d/77-mm-ericsson-mbm.rules 32006
-lib/udev/rules.d/77-mm-huawei-net-port-types.rules 32005
-lib/udev/rules.d/77-mm-longcheer-port-types.rules 32004
-lib/udev/rules.d/77-mm-mtk-port-types.rules 32003
-lib/udev/rules.d/77-mm-nokia-port-types.rules 32002
-lib/udev/rules.d/77-mm-pcmcia-device-blacklist.rules 32001
-lib/udev/rules.d/77-mm-platform-serial-whitelist.rules 32000
-lib/udev/rules.d/77-mm-qdl-device-blacklist.rules 31999
-lib/udev/rules.d/77-mm-simtech-port-types.rules 31998
-lib/udev/rules.d/77-mm-telit-port-types.rules 31997
-lib/udev/rules.d/77-mm-usb-device-blacklist.rules 31996
-lib/udev/rules.d/77-mm-usb-serial-adapters-greylist.rules 31995
-lib/udev/rules.d/77-mm-x22x-port-types.rules 31994
-lib/udev/rules.d/77-mm-zte-port-types.rules 31993
-lib/udev/rules.d/77-nm-olpc-mesh.rules 31992
-lib/udev/rules.d/78-sound-card.rules 31991
-lib/udev/rules.d/80-drivers.rules 31990
-lib/udev/rules.d/80-mm-candidate.rules 31989
-lib/udev/rules.d/80-net-setup-link.rules 31988
-lib/udev/rules.d/80-networking.rules 31987
-lib/udev/rules.d/80-udisks2.rules 31986
-lib/udev/rules.d/85-hdparm.rules 31985
-lib/udev/rules.d/85-hwclock.rules 31984
-lib/udev/rules.d/85-regulatory.rules 31983
-lib/udev/rules.d/90-alsa-restore.rules 31982
-lib/udev/rules.d/90-pulseaudio.rules 31981
-lib/udev/rules.d/92-libccid.rules 31980
-lib/udev/rules.d/95-cd-devices.rules 31979
-bin/setupcon 31978
-lib/udev/rules.d/95-udev-late.rules 31977
-lib/udev/rules.d/95-upower-csr.rules 31976
-lib/udev/rules.d/95-upower-hid.rules 31975
-lib/udev/rules.d/95-upower-wup.rules 31974
-etc/udev/rules.d/99-hide-TailsData.rules 31973
-lib/udev/rules.d/99-laptop-mode.rules 31972
-etc/udev/rules.d/99-make-removable-devices-user-writable.rules 31971
-lib/udev/rules.d/99-systemd.rules 31970
-etc/default/console-setup 31969
-etc/default/keyboard 31968
-lib/systemd/systemd-cgroups-agent 31966
-bin/uname 31965
-sbin/lvm 31964
-sbin/killall5 31963
-lib/udev/udev-finish 31962
-bin/stty 31961
-bin/egrep 31960
-usr/bin/tty 31959
-bin/kbd_mode 31958
-etc/sysctl.conf 31957
-usr/bin/ckbcomp 31955
-usr/share/perl/5.20.2/locale.pm 31954
-usr/share/perl/5.20.2/utf8.pm 31953
-usr/share/perl/5.20.2/utf8_heavy.pl 31952
-usr/share/perl/5.20.2/unicore/Heavy.pl 31951
-usr/share/perl/5.20.2/unicore/lib/Alpha/Y.pl 31950
-usr/share/X11/xkb/rules/base 31949
-usr/share/X11/xkb/keycodes/xfree86 31948
-usr/share/X11/xkb/keycodes/aliases 31947
-usr/share/X11/xkb/symbols/pc 31946
-usr/share/X11/xkb/symbols/srvr_ctrl 31945
-usr/share/X11/xkb/symbols/keypad 31944
-usr/share/X11/xkb/symbols/altwin 31943
-usr/share/X11/xkb/symbols/us 31942
-usr/share/X11/xkb/symbols/inet 31941
-lib/i386-linux-gnu/libudev.so.1.5.0 31940
-lib/i386-linux-gnu/libdevmapper-event.so.1.02.1 31939
-lib/i386-linux-gnu/libdevmapper.so.1.02.1 31938
-lib/i386-linux-gnu/libreadline.so.5.2 31937
-etc/lvm/lvm.conf 31936
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/gpu/drm/qxl/qxl.ko 31926
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/i2c/busses/i2c-piix4.ko 31923
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/soundcore.ko 31915
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/char/virtio_console.ko 31913
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/input/evdev.ko 31905
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/char/tpm/tpm.ko 31904
-lib/udev/cdrom_id 31902
-etc/console-setup/remap.inc 31901
-lib/udev/lmt-udev 31898
-lib/udev/hotplug.functions 31885
-usr/sbin/laptop_mode 31884
-bin/loadkeys 31883
-etc/laptop-mode/conf.d/ac97-powersave.conf 31882
-etc/laptop-mode/conf.d/auto-hibernate.conf 31877
-etc/laptop-mode/conf.d/battery-level-polling.conf 31876
-etc/laptop-mode/conf.d/bluetooth.conf 31875
-etc/laptop-mode/conf.d/configuration-file-control.conf 31874
-etc/laptop-mode/conf.d/cpufreq.conf 31873
-etc/laptop-mode/conf.d/dpms-standby.conf 31872
-etc/laptop-mode/conf.d/eee-superhe.conf 31871
-etc/laptop-mode/conf.d/ethernet.conf 31870
-etc/laptop-mode/conf.d/exec-commands.conf 31869
-etc/laptop-mode/conf.d/hal-polling.conf 31868
-etc/laptop-mode/conf.d/intel-hda-powersave.conf 31867
-etc/laptop-mode/conf.d/intel-sata-powermgmt.conf 31866
-etc/laptop-mode/conf.d/intel_pstate.conf 31865
-etc/laptop-mode/conf.d/lcd-brightness.conf 31864
-etc/laptop-mode/conf.d/nmi-watchdog.conf 31863
-etc/laptop-mode/conf.d/pcie-aspm.conf 31862
-etc/laptop-mode/conf.d/radeon-dpm.conf 31861
-etc/laptop-mode/conf.d/runtime-pm.conf 31860
-etc/laptop-mode/conf.d/sched-mc-power-savings.conf 31859
-etc/laptop-mode/conf.d/sched-smt-power-savings.conf 31858
-etc/laptop-mode/conf.d/start-stop-programs.conf 31857
-etc/laptop-mode/conf.d/terminal-blanking.conf 31856
-etc/laptop-mode/conf.d/video-out.conf 31855
-etc/laptop-mode/conf.d/wireless-ipw-power.conf 31854
-etc/laptop-mode/conf.d/wireless-iwl-power.conf 31853
-etc/laptop-mode/conf.d/wireless-power.conf 31852
-etc/laptop-mode/laptop-mode.conf 31851
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/virtio/virtio_balloon.ko 31848
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/input/serio/serio_raw.ko 31847
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/input/joydev.ko 31839
-usr/bin/flock 31837
+bin/setupcon 32034
+etc/default/console-setup 32033
+etc/default/keyboard 32032
+lib/udev/rules.d/60-libsane.rules 32031
+bin/uname 32030
+lib/udev/rules.d/60-open-vm-tools.rules 32029
+lib/udev/rules.d/60-persistent-alsa.rules 32028
+lib/udev/rules.d/60-persistent-input.rules 32027
+lib/udev/rules.d/60-persistent-serial.rules 32026
+lib/udev/rules.d/60-persistent-storage-dm.rules 32025
+lib/udev/rules.d/60-persistent-storage-tape.rules 32024
+lib/udev/rules.d/60-persistent-storage.rules 32023
+lib/udev/rules.d/60-persistent-v4l.rules 32022
+etc/udev/rules.d/60-virtualbox-guest-dkms.rules 32021
+lib/udev/rules.d/61-accelerometer.rules 32020
+lib/udev/rules.d/61-gnome-settings-daemon-rfkill.rules 32019
+lib/udev/rules.d/64-btrfs.rules 32018
+lib/udev/rules.d/64-xorg-xkb.rules 32017
+lib/udev/rules.d/66-bilibop.rules 32016
+lib/udev/rules.d/69-cd-sensors.rules 32015
+lib/udev/rules.d/69-libmtp.rules 32014
+lib/udev/rules.d/69-lvm-metad.rules 32013
+lib/udev/rules.d/69-xorg-vmmouse.rules 32012
+lib/udev/rules.d/70-power-switch.rules 32011
+etc/udev/rules.d/70-protect-boot-medium-for-udisks.rules 32010
+lib/udev/rules.d/70-uaccess.rules 32009
+lib/udev/rules.d/71-seat.rules 32008
+lib/udev/rules.d/73-idrac.rules 32007
+lib/udev/rules.d/73-seat-late.rules 32006
+lib/udev/rules.d/75-net-description.rules 32005
+lib/udev/rules.d/75-probe_mtd.rules 32004
+lib/udev/rules.d/75-tty-description.rules 32003
+lib/udev/rules.d/77-mm-cinterion-port-types.rules 32002
+lib/udev/rules.d/77-mm-ericsson-mbm.rules 32001
+lib/udev/rules.d/77-mm-huawei-net-port-types.rules 32000
+lib/udev/rules.d/77-mm-longcheer-port-types.rules 31999
+lib/udev/rules.d/77-mm-mtk-port-types.rules 31998
+lib/udev/rules.d/77-mm-nokia-port-types.rules 31997
+lib/udev/rules.d/77-mm-pcmcia-device-blacklist.rules 31996
+lib/udev/rules.d/77-mm-platform-serial-whitelist.rules 31995
+lib/udev/rules.d/77-mm-qdl-device-blacklist.rules 31994
+lib/udev/rules.d/77-mm-simtech-port-types.rules 31993
+lib/udev/rules.d/77-mm-telit-port-types.rules 31992
+lib/udev/rules.d/77-mm-usb-device-blacklist.rules 31991
+lib/udev/rules.d/77-mm-usb-serial-adapters-greylist.rules 31990
+lib/udev/rules.d/77-mm-x22x-port-types.rules 31989
+lib/udev/rules.d/77-mm-zte-port-types.rules 31988
+lib/udev/rules.d/77-nm-olpc-mesh.rules 31987
+lib/udev/rules.d/78-sound-card.rules 31986
+lib/udev/rules.d/80-drivers.rules 31985
+lib/udev/rules.d/80-mm-candidate.rules 31984
+lib/udev/rules.d/80-net-setup-link.rules 31983
+lib/udev/rules.d/80-networking.rules 31982
+lib/udev/rules.d/80-udisks2.rules 31981
+lib/udev/rules.d/85-hdparm.rules 31980
+lib/udev/rules.d/85-hwclock.rules 31979
+lib/udev/rules.d/85-regulatory.rules 31978
+lib/udev/rules.d/90-alsa-restore.rules 31977
+lib/udev/rules.d/90-pulseaudio.rules 31976
+lib/udev/rules.d/92-libccid.rules 31975
+lib/udev/rules.d/95-cd-devices.rules 31974
+lib/udev/rules.d/95-udev-late.rules 31973
+lib/udev/rules.d/95-upower-csr.rules 31972
+lib/udev/rules.d/95-upower-hid.rules 31971
+lib/udev/rules.d/95-upower-wup.rules 31970
+etc/udev/rules.d/99-hide-TailsData.rules 31969
+lib/udev/rules.d/99-laptop-mode.rules 31968
+etc/udev/rules.d/99-make-removable-devices-user-writable.rules 31967
+lib/udev/rules.d/99-systemd.rules 31966
+sbin/killall5 31964
+bin/egrep 31963
+bin/stty 31962
+usr/bin/tty 31961
+bin/kbd_mode 31960
+etc/sysctl.conf 31959
+usr/bin/ckbcomp 31957
+usr/share/perl/5.20.2/locale.pm 31956
+usr/share/perl/5.20.2/utf8.pm 31955
+usr/share/perl/5.20.2/utf8_heavy.pl 31954
+usr/share/perl/5.20.2/unicore/Heavy.pl 31953
+usr/share/perl/5.20.2/unicore/lib/Alpha/Y.pl 31952
+usr/share/X11/xkb/rules/base 31951
+usr/share/X11/xkb/keycodes/xfree86 31947
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/soundcore.ko 31941
+usr/share/X11/xkb/keycodes/aliases 31938
+lib/udev/lmt-udev 31937
+usr/share/X11/xkb/symbols/pc 31936
+usr/share/X11/xkb/symbols/srvr_ctrl 31935
+usr/share/X11/xkb/symbols/keypad 31934
+usr/share/X11/xkb/symbols/altwin 31933
+usr/share/X11/xkb/symbols/us 31932
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/char/tpm/tpm.ko 31931
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/input/evdev.ko 31928
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/core/snd.ko 31920
+lib/udev/cdrom_id 31919
+lib/udev/hotplug.functions 31918
+usr/sbin/laptop_mode 31917
+usr/share/X11/xkb/symbols/inet 31909
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/virtio/virtio_balloon.ko 31905
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/char/virtio_console.ko 31903
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/input/serio/serio_raw.ko 31902
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/char/tpm/tpm_tis_core.ko 31901
+etc/laptop-mode/conf.d/ac97-powersave.conf 31900
+etc/console-setup/remap.inc 31899
+lib/udev/ata_id 31898
+etc/laptop-mode/conf.d/auto-hibernate.conf 31897
+etc/laptop-mode/conf.d/battery-level-polling.conf 31896
+etc/laptop-mode/conf.d/bluetooth.conf 31895
+etc/laptop-mode/conf.d/configuration-file-control.conf 31894
+etc/laptop-mode/conf.d/cpufreq.conf 31893
+etc/laptop-mode/conf.d/dpms-standby.conf 31892
+etc/laptop-mode/conf.d/eee-superhe.conf 31891
+etc/laptop-mode/conf.d/ethernet.conf 31890
+etc/laptop-mode/conf.d/exec-commands.conf 31889
+etc/laptop-mode/conf.d/hal-polling.conf 31888
+etc/laptop-mode/conf.d/intel-hda-powersave.conf 31887
+etc/laptop-mode/conf.d/intel-sata-powermgmt.conf 31886
+etc/laptop-mode/conf.d/intel_pstate.conf 31885
+etc/laptop-mode/conf.d/lcd-brightness.conf 31884
+etc/laptop-mode/conf.d/nmi-watchdog.conf 31883
+etc/laptop-mode/conf.d/pcie-aspm.conf 31882
+etc/laptop-mode/conf.d/radeon-dpm.conf 31881
+etc/laptop-mode/conf.d/runtime-pm.conf 31880
+etc/laptop-mode/conf.d/sched-mc-power-savings.conf 31879
+etc/laptop-mode/conf.d/sched-smt-power-savings.conf 31878
+etc/laptop-mode/conf.d/start-stop-programs.conf 31877
+etc/laptop-mode/conf.d/terminal-blanking.conf 31876
+etc/laptop-mode/conf.d/video-out.conf 31875
+etc/laptop-mode/conf.d/wireless-ipw-power.conf 31874
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/char/tpm/tpm_tis.ko 31873
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/cpufreq/acpi-cpufreq.ko 31872
+run/udev/links/\x2frtc/c253:0 31864
+lib/udev/hwclock-set 31862
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/arch/x86/crypto/ghash-clmulni-intel.ko 31850
+etc/laptop-mode/conf.d/wireless-iwl-power.conf 31849
+etc/laptop-mode/conf.d/wireless-power.conf 31848
+etc/laptop-mode/laptop-mode.conf 31847
+usr/bin/flock 31845
+bin/loadkeys 31844
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/cpufreq/pcc-cpufreq.ko 31842
+lib/systemd/systemd-cgroups-agent 31841
+sbin/plymouthd 31840
+lib/i386-linux-gnu/libply-splash-core.so.2.1.0 31839
+usr/bin/logger 31838
+lib/i386-linux-gnu/libudev.so.1.5.0 31837
lib/systemd/systemd-remount-fs 31836
-sbin/plymouthd 31835
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/char/tpm/tpm_tis.ko 31834
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/core/snd.ko 31832
-run/udev/links/\x2frtc/c253:0 31824
-lib/udev/hwclock-set 31822
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/cryptd.ko 31819
-lib/udev/ata_id 31818
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/cpufreq/acpi-cpufreq.ko 31813
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/cpufreq/pcc-cpufreq.ko 31812
-lib/udev/net.agent 31744
-usr/bin/logger 31585
-bin/vmmouse_detect 31584
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/core/snd-timer.ko 31582
-lib/i386-linux-gnu/libply-splash-core.so.2.1.0 31581
-usr/share/laptop-mode-tools/modules/runtime-pm 31580
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/core/snd-pcm.ko 31579
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/core/snd-hwdep.ko 31577
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/hda/snd-hda-core.ko 31576
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/ablk_helper.ko 31575
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/glue_helper.ko 31574
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/gf128mul.ko 31573
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/lrw.ko 31572
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/aes-x86_64.ko 31571
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/pci/hda/snd-hda-codec.ko 31568
-run/udev/links/\x2fcdrom/b11:0 31565
-run/udev/links/\x2fdisk\x2fby-id\x2fata-QEMU_DVD-ROM_QM00001/b11:0 31564
-run/udev/links/\x2fdisk\x2fby-label\x2fTAILS\x5cx202.9\x5cx20-\x5cx2020161212/b11:0 31563
-run/udev/links/\x2fdisk\x2fby-uuid\x2f2016-12-12-16-12-43-00/b11:0 31562
-run/udev/links/\x2fdvd/b11:0 31561
-lib/systemd/debian-fixup 31559
-bin/systemctl 31558
-etc/init.d/alsa-utils 31557
-bin/systemd-tmpfiles 31556
-etc/init.d/kbd 31555
-etc/kbd/config 31554
-etc/init.d/live-tools 31553
-lib/systemd/systemd-random-seed 31552
-usr/lib/tmpfiles.d/debian.conf 31551
-usr/lib/tmpfiles.d/gvfsd-fuse-tmpfiles.conf 31550
-run/tmpfiles.d/kmod.conf 31549
-usr/lib/tmpfiles.d/laptop-mode.conf 31548
-usr/lib/tmpfiles.d/legacy.conf 31547
-usr/lib/tmpfiles.d/lvm2.conf 31546
-usr/lib/tmpfiles.d/man-db.conf 31545
-usr/lib/tmpfiles.d/systemd-nologin.conf 31544
-usr/lib/tmpfiles.d/systemd.conf 31543
-etc/machine-id 31542
-usr/lib/tmpfiles.d/tmp.conf 31541
-usr/lib/tmpfiles.d/tor-has-bootstrapped.conf 31540
-usr/lib/tmpfiles.d/var.conf 31539
-usr/lib/tmpfiles.d/x11.conf 31538
-usr/share/alsa/utils.sh 31536
-var/log/wtmp 31533
-var/log/btmp 31532
-lib/systemd/systemd-update-utmp 31530
-etc/systemd/logind.conf 31529
-etc/init.d/networking 31528
-usr/bin/seq 31527
-etc/default/networking 31526
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/pci/hda/snd-hda-intel.ko 31524
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/aesni-intel.ko 31523
-usr/bin/setterm 31522
-etc/init.d/console-setup 31521
-sbin/ifup 31520
-lib/live/mount/overlay/etc/network/interfaces 31519
-etc/macchanger/ifupdown.sh 31517
-etc/default/macchanger 31516
-etc/network/if-pre-up.d/wireless-tools 31514
-etc/wpa_supplicant/ifupdown.sh 31513
-etc/wpa_supplicant/functions.sh 31512
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/sound/pci/hda/snd-hda-codec-generic.ko 31511
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/ansi_cprng.ko 31510
-lib/systemd/system/sound.target 31506
+usr/share/laptop-mode-tools/modules/runtime-pm 31817
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/arch/x86/crypto/crc32-pclmul.ko 31792
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/gpu/drm/qxl/qxl.ko 31691
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/arch/x86/crypto/crct10dif-pclmul.ko 31670
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/core/snd-timer.ko 31669
+lib/udev/net.agent 31662
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/powercap/intel_rapl.ko 31634
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/input/joydev.ko 31615
+bin/vmmouse_detect 31548
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/core/snd-pcm.ko 31545
+run/udev/links/\x2fcdrom/b11:0 31541
+run/udev/links/\x2fdisk\x2fby-id\x2fata-QEMU_DVD-ROM_QM00001/b11:0 31540
+run/udev/links/\x2fdisk\x2fby-label\x2fTAILS\x5cx202.10\x5cx20-\x5cx2020170123/b11:0 31539
+run/udev/links/\x2fdisk\x2fby-uuid\x2f2017-01-23-19-01-50-00/b11:0 31538
+run/udev/links/\x2fdvd/b11:0 31537
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/i2c/busses/i2c-piix4.ko 31534
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/core/snd-hwdep.ko 31525
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/hda/snd-hda-core.ko 31524
+lib/systemd/debian-fixup 31523
+lib/systemd/systemd-random-seed 31522
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/pci/hda/snd-hda-codec.ko 31516
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/pci/hda/snd-hda-intel.ko 31515
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/sound/pci/hda/snd-hda-codec-generic.ko 31513
+lib/udev/udev-finish 31512
+sbin/lvm 31511
+lib/systemd/system/sound.target 31504
usr/sbin/alsactl 31503
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/drbg.ko 31502
-etc/network/if-up.d/mountnfs 31501
-usr/share/consolefonts/Uni1-Fixed16.psf.gz 31500
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/crypto/hmac.ko 31499
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/ghash-clmulni-intel.ko 31498
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/crc32-pclmul.ko 31497
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/arch/x86/crypto/crct10dif-pclmul.ko 31496
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/thermal/intel_powerclamp.ko 31495
-etc/console-setup/cached_UTF-8_del.kmap.gz 31494
-usr/lib/i386-linux-gnu/libasound.so.2.0.0 31493
-etc/network/if-up.d/upstart 31492
-bin/gzip 31491
-bin/setfont 31490
-etc/init.d/ferm 31489
-etc/default/ferm 31488
-usr/sbin/ferm 31487
-usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec.pm 31486
-usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec/Unix.pm 31485
-etc/ferm/ferm.conf 31484
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/powercap/intel_rapl.ko 31483
-sbin/xtables-multi 31482
-lib/libip4tc.so.0.1.0 31481
-lib/libip6tc.so.0.1.0 31480
-lib/libxtables.so.10.0.0 31479
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/x_tables.ko 31478
-usr/share/alsa/alsa.conf 31476
-usr/share/alsa/alsa.conf.d/50-pulseaudio.conf 31475
-usr/share/alsa/alsa.conf.d/pulse.conf 31474
-etc/asound.conf 31473
-usr/lib/i386-linux-gnu/alsa-lib/libasound_module_conf_pulse.so 31472
-usr/lib/i386-linux-gnu/libpulse.so.0.17.3 31471
-lib/i386-linux-gnu/libjson-c.so.2.0.0 31470
-usr/lib/i386-linux-gnu/pulseaudio/libpulsecommon-5.0.so 31469
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/ip_tables.ko 31468
-usr/lib/i386-linux-gnu/libX11-xcb.so.1.0.0 31467
-usr/lib/i386-linux-gnu/libICE.so.6.3.0 31466
-usr/lib/i386-linux-gnu/libSM.so.6.0.1 31465
-usr/lib/i386-linux-gnu/libXtst.so.6.1.0 31464
-lib/i386-linux-gnu/libwrap.so.0.7.6 31463
-usr/lib/i386-linux-gnu/libsndfile.so.1.0.25 31462
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/iptable_filter.ko 31461
-lib/xtables/libxt_state.so 31460
-usr/lib/i386-linux-gnu/libasyncns.so.0.3.1 31459
-usr/lib/i386-linux-gnu/libXext.so.6.4.0 31458
-usr/lib/i386-linux-gnu/libXi.so.6.1.0 31457
-usr/lib/i386-linux-gnu/libFLAC.so.8.3.0 31456
-usr/lib/i386-linux-gnu/libvorbisenc.so.2.0.10 31455
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/nf_conntrack.ko 31454
-usr/lib/i386-linux-gnu/libogg.so.0.8.2 31453
-usr/lib/i386-linux-gnu/libvorbis.so.0.4.7 31452
-etc/pulse/client.conf 31451
-usr/share/alsa/init/00main 31450
-usr/share/alsa/init/hda 31449
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_conntrack.ko 31448
-usr/share/alsa/init/default 31447
-lib/xtables/libxt_standard.so 31445
-etc/protocols 31444
-lib/xtables/libxt_tcp.so 31443
-lib/xtables/libxt_owner.so 31442
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_owner.ko 31441
-lib/xtables/libxt_multiport.so 31440
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_multiport.ko 31439
-lib/xtables/libxt_udp.so 31438
-etc/gai.conf 31437
-etc/services 31436
-lib/xtables/libipt_LOG.so 31435
-lib/xtables/libipt_REJECT.so 31434
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_tcpudp.ko 31433
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_LOG.ko 31432
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/nf_reject_ipv4.ko 31431
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/ipt_REJECT.ko 31430
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/nf_defrag_ipv4.ko 31429
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/nf_conntrack_ipv4.ko 31428
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/nf_log_common.ko 31427
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/nf_log_ipv4.ko 31426
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/nf_nat.ko 31425
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/nf_nat_ipv4.ko 31424
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv4/netfilter/iptable_nat.ko 31423
-lib/xtables/libipt_REDIRECT.so 31422
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/nf_nat_redirect.ko 31421
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/netfilter/xt_REDIRECT.ko 31420
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/ip6_tables.ko 31419
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/ip6table_filter.ko 31418
-lib/xtables/libip6t_LOG.so 31417
-lib/xtables/libip6t_REJECT.so 31416
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/nf_reject_ipv6.ko 31415
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/ip6t_REJECT.ko 31414
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/nf_defrag_ipv6.ko 31413
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/nf_conntrack_ipv6.ko 31412
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/ipv6/netfilter/nf_log_ipv6.ko 31411
-etc/default/cron 31410
-usr/sbin/ModemManager 31409
-usr/lib/accountsservice/accounts-daemon 31408
-usr/lib/i386-linux-gnu/libpolkit-gobject-1.so.0.0.0 31407
-usr/sbin/haveged 31406
-etc/ppp/ip-down.d/0000usepeerdns 31405
-usr/lib/i386-linux-gnu/libhavege.so.1.1.0 31404
-usr/local/lib/tails-shell-library/tor.sh 31403
-bin/sleep 31402
-etc/rc.local 31401
-usr/sbin/cron 31400
-etc/init.d/ekeyd 31399
-etc/init.d/rng-tools 31398
-etc/init.d/spice-vdagent 31397
-etc/init.d/virtualbox-guest-utils 31396
-etc/default/rng-tools 31395
-etc/dbus-1/system.conf 31394
-etc/dbus-1/system.d/com.hp.hplip.conf 31393
-etc/dbus-1/system.d/com.redhat.NewPrinterNotification.conf 31392
-etc/dbus-1/system.d/com.redhat.PrinterDriversInstaller.conf 31391
-etc/dbus-1/system.d/gdm.conf 31390
-etc/dbus-1/system.d/nm-avahi-autoipd.conf 31389
-etc/dbus-1/system.d/nm-dispatcher.conf 31388
-etc/dbus-1/system.d/org.freedesktop.Accounts.conf 31386
-etc/dbus-1/system.d/org.freedesktop.ColorManager.conf 31385
-etc/dbus-1/system.d/org.freedesktop.ModemManager1.conf 31384
-etc/init.d/kexec-load 31383
-etc/crontab 31382
-etc/init.d/speech-dispatcher 31380
-etc/dbus-1/system.d/org.freedesktop.NetworkManager.conf 31379
-etc/dbus-1/system.d/org.freedesktop.PolicyKit1.conf 31378
-etc/dbus-1/system.d/org.freedesktop.UDisks2.conf 31377
-etc/dbus-1/system.d/org.freedesktop.UPower.conf 31376
-etc/dbus-1/system.d/org.freedesktop.hostname1.conf 31375
-etc/dbus-1/system.d/org.freedesktop.locale1.conf 31374
-etc/dbus-1/system.d/org.freedesktop.login1.conf 31373
-etc/dbus-1/system.d/org.freedesktop.machine1.conf 31372
-etc/dbus-1/system.d/org.freedesktop.systemd1.conf 31371
-etc/dbus-1/system.d/org.freedesktop.timedate1.conf 31370
-etc/dbus-1/system.d/org.opensuse.CupsPkHelper.Mechanism.conf 31369
-etc/dbus-1/system.d/pulseaudio-system.conf 31368
-etc/dbus-1/system.d/wpa_supplicant.conf 31367
-usr/share/dbus-1/system-services/com.hp.hplip.service 31366
-usr/share/dbus-1/system-services/fi.epitest.hostap.WPASupplicant.service 31365
-usr/share/dbus-1/system-services/fi.w1.wpa_supplicant1.service 31364
-usr/share/dbus-1/system-services/org.freedesktop.Accounts.service 31363
-usr/share/dbus-1/system-services/org.freedesktop.ColorManager.service 31362
-usr/share/dbus-1/system-services/org.freedesktop.ModemManager1.service 31361
-usr/share/dbus-1/system-services/org.freedesktop.PolicyKit1.service 31360
-usr/share/dbus-1/system-services/org.freedesktop.UDisks2.service 31359
-usr/share/dbus-1/system-services/org.freedesktop.UPower.service 31358
-usr/share/dbus-1/system-services/org.freedesktop.hostname1.service 31357
-usr/share/dbus-1/system-services/org.freedesktop.locale1.service 31356
-usr/share/dbus-1/system-services/org.freedesktop.login1.service 31355
-usr/share/dbus-1/system-services/org.freedesktop.machine1.service 31354
-usr/share/dbus-1/system-services/org.freedesktop.nm_dispatcher.service 31353
-usr/share/dbus-1/system-services/org.freedesktop.timedate1.service 31352
-usr/share/dbus-1/system-services/org.opensuse.CupsPkHelper.Mechanism.service 31351
-lib/systemd/systemd-logind 31350
-usr/local/lib/tor-controlport-filter 31349
-usr/local/sbin/tails-reconfigure-memlockd 31348
-etc/default/ekeyd 31347
-usr/local/sbin/tails-reconfigure-kexec 31346
-usr/local/lib/tails-set-wireless-devices-state 31345
-usr/local/bin/tails-get-bootinfo 31344
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/input/misc/uinput.ko 31343
-etc/memlockd.cfg 31342
-sbin/start-stop-daemon 31341
-usr/sbin/ekeyd 31340
-etc/default/speech-dispatcher 31339
-bin/echo 31338
-usr/local/bin/tails-boot-to-kexec 31337
-usr/lib/i386-linux-gnu/gio/modules/libgvfsdbus.so 31335
-usr/lib/i386-linux-gnu/gvfs/libgvfscommon.so 31334
-usr/lib/i386-linux-gnu/libbluray.so.1.6.2 31333
-lib/systemd/systemd-user-sessions 31332
-usr/lib/i386-linux-gnu/libgudev-1.0.so.0.2.0 31331
-etc/default/kexec 31330
-usr/lib/python2.7/socket.py 31327
-usr/lib/i386-linux-gnu/libfreetype.so.6.11.1 31326
-usr/lib/i386-linux-gnu/libmm-glib.so.0.2.0 31325
-usr/lib/python2.7/lib-dynload/_ssl.i386-linux-gnu.so 31324
-usr/lib/i386-linux-gnu/liblua5.1.so.0.0.0 31323
-usr/sbin/spice-vdagentd 31322
-etc/X11/default-display-manager 31320
-usr/share/gdm/generate-config 31319
-usr/sbin/memlockd 31318
-usr/local/lib/udev-watchdog-wrapper 31317
-usr/lib/i386-linux-gnu/libstdc++.so.6.0.20 31316
-usr/share/lua/5.1/socket.lua 31315
-usr/lib/i386-linux-gnu/libqmi-glib.so.1.2.0 31314
-usr/lib/i386-linux-gnu/liblua5.1-socket.so.2.0.0 31313
-usr/lib/i386-linux-gnu/liblua5.1-socket-unix.so.2.0.0 31312
-etc/entropykey/ekeyd.conf 31311
-etc/entropykey/keyring 31310
-usr/bin/eject 31308
-lib/i386-linux-gnu/libpng12.so.0.50.0 31307
-lib/systemd/system/polkitd.service 31306
-usr/bin/dconf 31305
-usr/lib/i386-linux-gnu/libdconf.so.1.0.0 31304
-etc/gdm3/greeter.dconf-defaults 31303
-usr/share/gdm/dconf/50-tails 31302
-usr/share/gdm/dconf/00-upstream-settings 31301
-usr/share/gdm/dconf/locks/00-upstream-settings-locks 31300
-usr/lib/policykit-1/polkitd 31299
-usr/sbin/gdm3 31298
-usr/lib/i386-linux-gnu/libpolkit-backend-1.so.0.0.0 31297
-usr/lib/i386-linux-gnu/libXrandr.so.2.2.0 31296
-usr/lib/i386-linux-gnu/libXrender.so.1.3.0 31295
-usr/lib/i386-linux-gnu/polkit-1/extensions/libnullbackend.so 31294
-usr/local/sbin/udev-watchdog 31293
-lib/i386-linux-gnu/libgcc_s.so.1 31292
-etc/polkit-1/nullbackend.conf.d/50-nullbackend.conf 31291
-usr/lib/i386-linux-gnu/libpciaccess.so.0.11.1 31290
-usr/lib/i386-linux-gnu/libmbim-glib.so.4.0.0 31289
-etc/gdm3/daemon.conf 31288
-usr/share/gdm/gdm.schemas 31287
-usr/bin/ldd 31286
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-altair-lte.so 31284
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-anydata.so 31283
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-cinterion.so 31282
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-generic.so 31281
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-gobi.so 31280
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-hso.so 31279
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-huawei.so 31278
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-iridium.so 31277
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-linktop.so 31276
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-longcheer.so 31275
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-mbm.so 31274
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-motorola.so 31273
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-mtk.so 31272
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-nokia-icera.so 31271
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-nokia.so 31270
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-novatel-lte.so 31269
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-novatel.so 31268
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-option.so 31267
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-pantech.so 31266
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-samsung.so 31265
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-sierra.so 31264
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-simtech.so 31263
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-telit.so 31262
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-via.so 31261
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-wavecom.so 31260
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-x22x.so 31259
-usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-zte.so 31258
-usr/bin/Xorg 31257
-lib/systemd/system-shutdown/tails-kexec 31256
-sbin/kexec 31255
-usr/bin/pgrep 31254
-lib/i386-linux-gnu/libprocps.so.3.0.0 31253
-lib/live/mount/medium/live/vmlinuz2 31252
-lib/live/mount/medium/live/initrd2.img 31251
-usr/lib/i386-linux-gnu/libdrm.so.2.4.0 31250
-usr/lib/i386-linux-gnu/libpixman-1.so.0.32.6 31249
-usr/lib/i386-linux-gnu/libXfont.so.1.4.1 31248
-usr/lib/i386-linux-gnu/libxshmfence.so.1.0.0 31247
-usr/lib/i386-linux-gnu/libfontenc.so.1.0.0 31246
-usr/lib/xorg/protocol.txt 31244
-usr/share/X11/xorg.conf.d/10-evdev.conf 31243
-usr/share/X11/xorg.conf.d/10-quirks.conf 31242
-usr/share/X11/xorg.conf.d/50-synaptics.conf 31241
-usr/share/X11/xorg.conf.d/50-vmmouse.conf 31240
-usr/share/X11/xorg.conf.d/90-tails.conf 31239
-usr/lib/xorg/modules/extensions/libglx.so 31238
-usr/lib/i386-linux-gnu/libGL.so.1.2.0 31237
-usr/lib/i386-linux-gnu/libxcb-dri3.so.0.0.0 31236
-usr/lib/i386-linux-gnu/libxcb-present.so.0.0.0 31235
-usr/lib/i386-linux-gnu/libxcb-sync.so.1.0.0 31234
-usr/lib/i386-linux-gnu/libglapi.so.0.0.0 31233
-usr/lib/i386-linux-gnu/libXdamage.so.1.1.0 31232
-usr/lib/i386-linux-gnu/libXfixes.so.3.1.0 31231
-usr/lib/i386-linux-gnu/libxcb-glx.so.0.0.0 31230
-usr/lib/i386-linux-gnu/libxcb-dri2.so.0.0.0 31229
-usr/lib/i386-linux-gnu/libXxf86vm.so.1.0.0 31228
-usr/lib/xorg/modules/drivers/qxl_drv.so 31227
-usr/lib/xorg/modules/libfb.so 31226
-usr/lib/xorg/modules/libvgahw.so 31225
-usr/lib/i386-linux-gnu/dri/swrast_dri.so 31224
-usr/lib/i386-linux-gnu/libdrm_nouveau.so.2.0.0 31223
-usr/lib/i386-linux-gnu/libdrm_radeon.so.1.0.1 31222
-usr/lib/i386-linux-gnu/libdrm_amdgpu.so.1.0.0 31221
-usr/lib/i386-linux-gnu/libelf-0.159.so 31220
-usr/lib/i386-linux-gnu/libLLVM-3.5.so.1 31219
-usr/lib/i386-linux-gnu/libedit.so.2.0.51 31218
-lib/i386-linux-gnu/libbsd.so.0.7.0 31217
-etc/drirc 31216
-usr/share/fonts/X11/misc/fonts.dir 31215
-usr/share/fonts/X11/misc/fonts.alias 31214
-usr/share/fonts/X11/100dpi/fonts.dir 31213
-usr/share/fonts/X11/100dpi/fonts.alias 31212
-usr/share/fonts/X11/75dpi/fonts.dir 31211
-usr/share/fonts/X11/75dpi/fonts.alias 31210
-usr/share/fonts/X11/Type1/fonts.dir 31209
-usr/share/fonts/X11/misc/6x13-ISO8859-1.pcf.gz 31208
-usr/share/fonts/X11/misc/cursor.pcf.gz 31207
-usr/share/X11/xkb/rules/evdev 31206
-usr/bin/xkbcomp 31205
-usr/lib/i386-linux-gnu/libxkbfile.so.1.0.2 31204
-usr/share/X11/xkb/keycodes/evdev 31203
-usr/share/X11/xkb/geometry/pc 31202
-usr/share/X11/xkb/types/complete 31201
-usr/share/X11/xkb/types/basic 31200
-usr/share/X11/xkb/types/mousekeys 31199
-usr/share/X11/xkb/types/pc 31198
-usr/share/X11/xkb/types/iso9995 31197
-usr/share/X11/xkb/types/level5 31196
-usr/share/X11/xkb/types/extra 31195
-usr/share/X11/xkb/types/numpad 31194
-usr/share/X11/xkb/compat/complete 31193
-usr/share/X11/xkb/compat/basic 31192
-usr/share/X11/xkb/compat/ledcaps 31191
-usr/share/X11/xkb/compat/lednum 31190
-usr/share/X11/xkb/compat/iso9995 31189
-usr/share/X11/xkb/compat/mousekeys 31188
-usr/share/X11/xkb/compat/accessx 31187
-usr/share/X11/xkb/compat/misc 31186
-usr/share/X11/xkb/compat/ledscroll 31185
-usr/share/X11/xkb/compat/xfree86 31184
-usr/share/X11/xkb/compat/level5 31183
-usr/share/X11/xkb/compat/caps 31182
-usr/lib/xorg/modules/input/evdev_drv.so 31181
-usr/lib/i386-linux-gnu/libmtdev.so.1.0.0 31180
-usr/lib/i386-linux-gnu/libevdev.so.2.1.3 31179
-usr/lib/xorg/modules/input/vmmouse_drv.so 31174
-etc/gdm3/Init/Default 31173
-usr/lib/gdm3/gdm-session-worker 31172
-usr/lib/libaccountsservice.so.0.0.0 31171
-etc/pam.d/gdm-launch-environment 31170
-lib/i386-linux-gnu/security/pam_nologin.so 31169
-lib/i386-linux-gnu/security/pam_keyinit.so 31168
-lib/i386-linux-gnu/security/pam_limits.so 31167
-lib/i386-linux-gnu/security/pam_env.so 31166
-usr/share/gdm/BuiltInSessions/default.desktop 31165
-usr/share/polkit-1/actions/com.hp.hplip.policy 31164
-usr/share/polkit-1/actions/com.ubuntu.pkexec.synaptic.policy 31163
-usr/share/polkit-1/actions/org.debian.pkexec.gnome-system-log.policy 31162
-usr/share/polkit-1/actions/org.freedesktop.ModemManager1.policy 31161
-usr/share/polkit-1/actions/org.freedesktop.NetworkManager.policy 31160
-usr/share/polkit-1/actions/org.freedesktop.accounts.policy 31159
-usr/share/polkit-1/actions/org.freedesktop.color.policy 31158
-usr/share/polkit-1/actions/org.freedesktop.hostname1.policy 31157
-usr/share/polkit-1/actions/org.freedesktop.locale1.policy 31156
-usr/share/polkit-1/actions/org.freedesktop.login1.policy 31155
-usr/share/polkit-1/actions/org.freedesktop.policykit.policy 31154
-usr/share/polkit-1/actions/org.freedesktop.systemd1.policy 31153
-usr/share/polkit-1/actions/org.freedesktop.timedate1.policy 31152
-usr/share/polkit-1/actions/org.freedesktop.udisks2.policy 31151
-usr/share/polkit-1/actions/org.gnome.controlcenter.datetime.policy 31150
-usr/share/polkit-1/actions/org.gnome.controlcenter.remote-login-helper.policy 31149
-usr/share/polkit-1/actions/org.gnome.controlcenter.user-accounts.policy 31148
-usr/share/polkit-1/actions/org.gnome.gnome-system-monitor.policy 31147
-usr/share/polkit-1/actions/org.gnome.settings-daemon.plugins.power.policy 31146
-usr/share/polkit-1/actions/org.gnome.settings-daemon.plugins.wacom.policy 31145
-usr/share/polkit-1/actions/org.opensuse.cupspkhelper.mechanism.policy 31144
-usr/share/polkit-1/actions/org.x.xf86-video-intel.backlight-helper.policy 31143
-etc/security/limits.conf 31142
-etc/security/pam_env.conf 31141
-etc/environment 31140
-lib/systemd/system/user@.service 31139
-etc/pam.d/systemd-user 31137
-lib/systemd/systemd 31131
-etc/systemd/user.conf 31130
-lib/systemd/system/shutdown.target 31128
-usr/lib/systemd/user/default.target 31127
-usr/lib/systemd/user/basic.target 31126
-usr/lib/systemd/user/tails-create-tor-browser-directories.service 31125
-usr/lib/systemd/user/tails-add-GNOME-bookmarks.service 31124
-lib/systemd/system/paths.target 31123
-lib/systemd/system/timers.target 31122
-lib/systemd/system/sockets.target 31121
-usr/local/lib/add-GNOME-bookmarks 31120
-usr/bin/id 31119
-usr/local/lib/create-tor-browser-directories 31118
-usr/share/gdm/greeter/dbus-1/services/org.freedesktop.Telepathy.AccountManager.service 31117
-usr/share/gdm/greeter/dbus-1/services/org.freedesktop.Telepathy.MissionControl5.service 31116
-usr/share/gdm/greeter/dbus-1/services/org.gnome.OnlineAccounts.service 31115
-usr/bin/gnome-session 31114
-usr/lib/i386-linux-gnu/libjson-glib-1.0.so.0.0.2 31113
-usr/lib/libgnome-desktop-3.so.10.0.0 31112
-usr/lib/i386-linux-gnu/libgtk-3.so.0.1400.5 31111
-usr/lib/i386-linux-gnu/libgdk-3.so.0.1400.5 31110
-usr/lib/i386-linux-gnu/libcairo.so.2.11400.0 31109
-usr/lib/i386-linux-gnu/libgdk_pixbuf-2.0.so.0.3100.1 31108
-usr/lib/i386-linux-gnu/libpangocairo-1.0.so.0.3600.8 31107
-usr/lib/i386-linux-gnu/libXcomposite.so.1.0.0 31106
-usr/lib/i386-linux-gnu/libcairo-gobject.so.2.11400.0 31105
-usr/lib/i386-linux-gnu/libatk-1.0.so.0.21409.1 31104
-usr/lib/i386-linux-gnu/libatk-bridge-2.0.so.0.0.0 31103
-usr/lib/i386-linux-gnu/libpangoft2-1.0.so.0.3600.8 31102
-usr/lib/i386-linux-gnu/libpango-1.0.so.0.3600.8 31101
-usr/lib/i386-linux-gnu/libfontconfig.so.1.8.0 31100
-usr/lib/i386-linux-gnu/libXinerama.so.1.0.0 31099
-usr/lib/i386-linux-gnu/libXcursor.so.1.0.2 31098
-usr/lib/i386-linux-gnu/libwayland-client.so.0.3.0 31097
-usr/lib/i386-linux-gnu/libxkbcommon.so.0.0.0 31096
-usr/lib/i386-linux-gnu/libwayland-cursor.so.0.0.0 31095
-usr/lib/i386-linux-gnu/libxcb-shm.so.0.0.0 31094
-usr/lib/i386-linux-gnu/libxcb-render.so.0.0.0 31093
-usr/lib/i386-linux-gnu/libatspi.so.0.0.1 31092
-usr/lib/i386-linux-gnu/libharfbuzz.so.0.935.0 31091
-usr/lib/i386-linux-gnu/libthai.so.0.2.0 31090
-usr/lib/i386-linux-gnu/libgraphite2.so.3.0.1 31089
-usr/lib/i386-linux-gnu/libdatrie.so.1.3.1 31088
-usr/lib/gnome-session/gnome-session-check-accelerated 31087
-usr/share/locale/en/LC_MESSAGES/gtk30.mo 31086
-usr/share/locale/en/LC_MESSAGES/gtk30-properties.mo 31085
-usr/lib/at-spi2-core/at-spi-bus-launcher 31084
-usr/share/dconf/profile/gdm 31083
-etc/at-spi2/accessibility.conf 31082
-usr/lib/gnome-session/gnome-session-check-accelerated-helper 31081
-usr/lib/at-spi2-core/at-spi2-registryd 31080
-usr/share/gnome-session/hardware-compatibility 31079
-usr/share/gnome-session/sessions/gdm-tails.session 31078
-usr/share/applications/gnome-flashback.desktop 31077
-usr/share/applications/tails-greeter.desktop 31076
-usr/share/gnome/autostart/gnome-settings-daemon.desktop 31075
-usr/share/applications/metacity.desktop 31074
-usr/share/gdm/greeter/autostart/caribou-autostart.desktop 31073
-usr/share/gdm/greeter/autostart/orca-autostart.desktop 31072
-etc/xdg/autostart/spice-vdagent.desktop 31071
-usr/lib/gnome-settings-daemon/gnome-settings-daemon-localeexec 31070
-usr/bin/spice-vdagent 31069
-usr/lib/gnome-settings-daemon/gnome-settings-daemon 31068
-usr/lib/gnome-settings-daemon-3.0/libgsd.so 31067
-usr/lib/i386-linux-gnu/libnotify.so.4.0.0 31066
-usr/lib/gnome-settings-daemon-3.0/a11y-keyboard.gnome-settings-plugin 31065
-usr/lib/gnome-settings-daemon-3.0/a11y-settings.gnome-settings-plugin 31064
-usr/lib/gnome-settings-daemon-3.0/clipboard.gnome-settings-plugin 31063
-usr/lib/gnome-settings-daemon-3.0/color.gnome-settings-plugin 31062
-usr/lib/gnome-settings-daemon-3.0/cursor.gnome-settings-plugin 31061
-usr/lib/gnome-settings-daemon-3.0/datetime.gnome-settings-plugin 31060
-usr/lib/gnome-settings-daemon-3.0/housekeeping.gnome-settings-plugin 31059
-usr/lib/gnome-settings-daemon-3.0/keyboard.gnome-settings-plugin 31058
-usr/lib/gnome-settings-daemon-3.0/media-keys.gnome-settings-plugin 31057
-usr/lib/gnome-settings-daemon-3.0/mouse.gnome-settings-plugin 31056
-usr/lib/gnome-settings-daemon-3.0/orientation.gnome-settings-plugin 31055
-usr/lib/gnome-settings-daemon-3.0/power.gnome-settings-plugin 31054
-usr/lib/gnome-settings-daemon-3.0/print-notifications.gnome-settings-plugin 31053
-usr/lib/gnome-settings-daemon-3.0/rfkill.gnome-settings-plugin 31052
-usr/lib/gnome-settings-daemon-3.0/screensaver-proxy.gnome-settings-plugin 31051
-usr/lib/gnome-settings-daemon-3.0/sharing.gnome-settings-plugin 31050
-usr/lib/gnome-settings-daemon-3.0/smartcard.gnome-settings-plugin 31049
-usr/lib/gnome-settings-daemon-3.0/sound.gnome-settings-plugin 31048
-usr/lib/gnome-settings-daemon-3.0/updates.gnome-settings-plugin 31047
-usr/lib/gnome-settings-daemon-3.0/wacom.gnome-settings-plugin 31046
-usr/lib/gnome-settings-daemon-3.0/xrandr.gnome-settings-plugin 31045
-usr/lib/gnome-settings-daemon-3.0/xsettings.gnome-settings-plugin 31044
-usr/lib/gnome-settings-daemon-3.0/libpower.so 31043
-usr/lib/i386-linux-gnu/libwacom.so.2.1.0 31042
-usr/lib/i386-linux-gnu/libupower-glib.so.3.0.0 31041
-usr/lib/i386-linux-gnu/libcanberra-gtk3.so.0.1.9 31040
-usr/lib/i386-linux-gnu/libcanberra.so.0.2.5 31039
-usr/lib/i386-linux-gnu/libvorbisfile.so.3.3.6 31038
-usr/lib/i386-linux-gnu/libtdb.so.1.3.6 31037
-usr/lib/i386-linux-gnu/libltdl.so.7.3.0 31036
-lib/systemd/system/upower.service 31035
-usr/lib/upower/upowerd 31034
-lib/i386-linux-gnu/libusb-1.0.so.0.1.0 31033
-usr/lib/i386-linux-gnu/libimobiledevice.so.4.0.1 31032
-usr/lib/i386-linux-gnu/libplist.so.2.0.0 31031
-usr/lib/i386-linux-gnu/libgnutls-deb0.so.28.41.0 31030
-usr/lib/i386-linux-gnu/libtasn1.so.6.3.2 31029
-usr/lib/i386-linux-gnu/libusbmuxd.so.2.1.0 31028
-usr/lib/i386-linux-gnu/libp11-kit.so.0.0.0 31027
-usr/lib/i386-linux-gnu/libnettle.so.4.7 31026
-usr/lib/i386-linux-gnu/libhogweed.so.2.5 31025
-usr/lib/i386-linux-gnu/libgmp.so.10.2.0 31024
-etc/UPower/UPower.conf 31023
-usr/lib/gnome-settings-daemon-3.0/libxsettings.so 31018
-usr/lib/gnome-settings-daemon-3.0/gtk-modules/at-spi2-atk.desktop 31017
-etc/fonts/fonts.conf 31016
-usr/share/fontconfig/conf.avail/10-scale-bitmap-fonts.conf 31015
-usr/share/fontconfig/conf.avail/11-lcdfilter-default.conf 31014
-etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-sans-mono.conf 31013
-etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-sans.conf 31012
-etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-serif.conf 31011
-etc/fonts/conf.avail/20-unhint-small-dejavu-sans-mono.conf 31010
-etc/fonts/conf.avail/20-unhint-small-dejavu-sans.conf 31009
-etc/fonts/conf.avail/20-unhint-small-dejavu-serif.conf 31008
-usr/share/fontconfig/conf.avail/20-unhint-small-vera.conf 31007
-etc/fonts/conf.avail/25-arphic-ukai-render.conf 31006
-etc/fonts/conf.avail/25-arphic-uming-render.conf 31005
-usr/share/fontconfig/conf.avail/30-metric-aliases.conf 31004
-usr/share/fontconfig/conf.avail/30-urw-aliases.conf 31003
-etc/fonts/conf.avail/31-cantarell.conf 31002
-etc/fonts/conf.avail/35-arphic-ukai-aliases.conf 31001
-etc/fonts/conf.avail/35-arphic-uming-aliases.conf 31000
-usr/share/fontconfig/conf.avail/40-nonlatin.conf 30999
-etc/fonts/conf.avail/41-arphic-ukai.conf 30998
-etc/fonts/conf.avail/41-arphic-uming.conf 30997
-usr/share/fontconfig/conf.avail/45-latin.conf 30996
-usr/share/fontconfig/conf.avail/49-sansserif.conf 30995
-usr/share/fontconfig/conf.avail/50-user.conf 30994
-usr/share/fontconfig/conf.avail/51-local.conf 30993
-etc/fonts/conf.avail/57-dejavu-sans-mono.conf 30992
-etc/fonts/conf.avail/57-dejavu-sans.conf 30991
-etc/fonts/conf.avail/57-dejavu-serif.conf 30990
-etc/fonts/conf.avail/58-dejavu-lgc-sans-mono.conf 30989
-etc/fonts/conf.avail/58-dejavu-lgc-sans.conf 30988
-etc/fonts/conf.avail/58-dejavu-lgc-serif.conf 30987
-usr/share/fontconfig/conf.avail/60-latin.conf 30986
-etc/fonts/conf.avail/64-01-tlwg-kinnari.conf 30985
-etc/fonts/conf.avail/64-02-tlwg-norasi.conf 30984
-etc/fonts/conf.avail/64-11-tlwg-waree.conf 30983
-etc/fonts/conf.avail/64-12-tlwg-loma.conf 30982
-etc/fonts/conf.avail/64-13-tlwg-garuda.conf 30981
-etc/fonts/conf.avail/64-14-tlwg-umpush.conf 30980
-etc/fonts/conf.avail/64-15-laksaman.conf 30979
-etc/fonts/conf.avail/64-21-tlwg-typo.conf 30978
-etc/fonts/conf.avail/64-22-tlwg-typist.conf 30977
-etc/fonts/conf.avail/64-23-tlwg-mono.conf 30976
-etc/fonts/conf.avail/64-arphic-uming.conf 30975
-etc/fonts/conf.avail/65-0-fonts-beng-extra.conf/65-0-fonts-beng-extra.conf 30974
-etc/fonts/conf.avail/65-0-fonts-deva-extra.conf/65-0-fonts-deva-extra.conf 30973
-etc/fonts/conf.avail/65-0-fonts-gubbi.conf 30972
-etc/fonts/conf.avail/65-0-fonts-gujr-extra.conf/65-0-fonts-gujr-extra.conf 30971
-etc/fonts/conf.avail/65-0-fonts-guru-extra.conf/65-0-fonts-guru-extra.conf 30970
-etc/fonts/conf.avail/65-0-fonts-orya-extra.conf/65-0-fonts-orya-extra.conf 30969
-etc/fonts/conf.avail/65-0-fonts-pagul.conf 30968
-etc/fonts/conf.avail/malayalam-fonts.conf 30967
-etc/fonts/conf.avail/65-0-fonts-telu-extra.conf 30966
-etc/fonts/conf.avail/65-culmus.conf 30965
-usr/share/fontconfig/conf.avail/65-fonts-persian.conf 30964
-etc/fonts/conf.d/65-khmer.conf 30963
-usr/share/fontconfig/conf.avail/65-nonlatin.conf 30962
-etc/fonts/conf.avail/66-lohit-assamese.conf 30961
-etc/fonts/conf.avail/66-lohit-bengali.conf 30960
-etc/fonts/conf.avail/66-lohit-devanagari.conf 30959
-etc/fonts/conf.avail/66-lohit-gujarati.conf 30958
-etc/fonts/conf.avail/66-lohit-kannada.conf 30957
-etc/fonts/conf.avail/66-lohit-oriya.conf 30956
-etc/fonts/conf.avail/66-lohit-punjabi.conf 30955
-etc/fonts/conf.avail/66-lohit-tamil-classical.conf 30954
-etc/fonts/conf.avail/66-lohit-tamil.conf 30953
-etc/fonts/conf.avail/66-lohit-telugu.conf 30952
-usr/share/fontconfig/conf.avail/69-unifont.conf 30951
-usr/share/fontconfig/conf.avail/70-no-bitmaps.conf 30950
-etc/fonts/conf.avail/75-arphic-ukai-select.conf 30949
-usr/share/fontconfig/conf.avail/80-delicious.conf 30948
-etc/fonts/conf.avail/85-xfonts-wqy.conf/85-wqy-bitmapsong.conf 30947
-etc/fonts/conf.avail/89-tlwg-garuda-synthetic.conf 30946
-etc/fonts/conf.avail/89-tlwg-kinnari-synthetic.conf 30945
-etc/fonts/conf.avail/89-tlwg-laksaman-synthetic.conf 30944
-etc/fonts/conf.avail/89-tlwg-loma-synthetic.conf 30943
-etc/fonts/conf.avail/89-tlwg-umpush-synthetic.conf 30942
-etc/fonts/conf.avail/89-tlwg-waree-synthetic.conf 30941
-etc/fonts/conf.avail/90-arphic-ukai-embolden.conf 30940
-etc/fonts/conf.avail/90-arphic-uming-embolden.conf 30939
-etc/fonts/conf.avail/90-fonts-linux-libertine.conf 30938
-usr/share/fontconfig/conf.avail/90-fonts-unfonts-core.conf 30937
-usr/share/fontconfig/conf.avail/90-synthetic.conf 30936
-etc/fonts/conf.d/99pdftoopvp.conf 30935
-var/cache/fontconfig/3830d5c3ddfd5cd38a049b759396e72e-le32d4.cache-4 30934
-var/cache/fontconfig/4c599c202bc5c08e2d34565a40eac3b2-le32d4.cache-4 30933
-var/cache/fontconfig/c855463f699352c367813e37f3f70ea7-le32d4.cache-4 30932
-var/cache/fontconfig/57e423e26b20ab21d0f2f29c145174c3-le32d4.cache-4 30931
-var/cache/fontconfig/573ec803664ed168555e0e8b6d0f0c7f-le32d4.cache-4 30930
-var/cache/fontconfig/7ef2298fde41cc6eeb7af42e48b7d293-le32d4.cache-4 30929
-var/cache/fontconfig/d82eb4fd963d448e2fcb7d7b793b5df3-le32d4.cache-4 30928
-var/cache/fontconfig/21a99156bb11811cef641abeda519a45-le32d4.cache-4 30927
-var/cache/fontconfig/eeebfc908bd29a90773fd860017aada4-le32d4.cache-4 30926
-var/cache/fontconfig/e13b20fdb08344e0e664864cc2ede53d-le32d4.cache-4 30925
-var/cache/fontconfig/707971e003b4ae6c8121c3a920e507f5-le32d4.cache-4 30924
-var/cache/fontconfig/cabbd14511b9e8a55e92af97fb3a0461-le32d4.cache-4 30923
-var/cache/fontconfig/fe547fea3a41b43a38975d292a2b19c7-le32d4.cache-4 30922
-var/cache/fontconfig/f1f2465696798768e9653f19e17ccdc8-le32d4.cache-4 30921
-var/cache/fontconfig/95530828ff6c81d309f8258d8d02a23e-le32d4.cache-4 30920
-var/cache/fontconfig/d3e5c4ee2ceb1fc347f91d4cefc53bc0-le32d4.cache-4 30919
-var/cache/fontconfig/e52a45a1c8c8fe895fc0fc8c4e6999b8-le32d4.cache-4 30918
-var/cache/fontconfig/188ac73a183f12857f63bb60a4a6d603-le32d4.cache-4 30917
-var/cache/fontconfig/62f91419b9ebdb6975e7e41ab6412357-le32d4.cache-4 30916
-var/cache/fontconfig/53d14c92082a93e67d5078324eb314ca-le32d4.cache-4 30915
-var/cache/fontconfig/f6e6e0a5c3d2f6ae0c0c2e0ecd42a997-le32d4.cache-4 30914
-var/cache/fontconfig/49f0de54bdd920fe4f0dfd4cbac43e6b-le32d4.cache-4 30913
-var/cache/fontconfig/85e0a52ce643a7ba2ae53e5d6949cead-le32d4.cache-4 30912
-var/cache/fontconfig/4d9c95eba1cb85bbcf2878543262124a-le32d4.cache-4 30911
-var/cache/fontconfig/089dead882dea3570ffc31a9898cfb69-le32d4.cache-4 30910
-var/cache/fontconfig/a0513722a37733a9dfd54dccd328039d-le32d4.cache-4 30909
-var/cache/fontconfig/d589a48862398ed80a3d6066f4f56f4c-le32d4.cache-4 30908
-var/cache/fontconfig/75994e804c4bf4eaf913a982c1a8d8e9-le32d4.cache-4 30907
-var/cache/fontconfig/674d1711f2d1d2a09646eb0bdcadee49-le32d4.cache-4 30906
-var/cache/fontconfig/550f3886151c940c12a5ed35f6a00586-le32d4.cache-4 30905
-var/cache/fontconfig/f259c2cffa685e28062317905db73c4a-le32d4.cache-4 30904
-var/cache/fontconfig/551ecf3b0e8b0bca0f25c0944f561853-le32d4.cache-4 30903
-var/cache/fontconfig/d5178ab6d91b49bf20a416737dcea9e8-le32d4.cache-4 30902
-var/cache/fontconfig/6b2c5944714ca7831b25bed9e85cb5c8-le32d4.cache-4 30901
-var/cache/fontconfig/370e5b74bf5dafc30834de68e24a87a4-le32d4.cache-4 30900
-var/cache/fontconfig/b47c4e1ecd0709278f4910c18777a504-le32d4.cache-4 30899
-var/cache/fontconfig/d512a7b9f4305a5cce37c9b1a598863a-le32d4.cache-4 30898
-var/cache/fontconfig/56cf4f4769d0f4abc89a4895d7bd3ae1-le32d4.cache-4 30897
-var/cache/fontconfig/3047814df9a2f067bd2d96a2b9c36e5a-le32d4.cache-4 30896
-var/cache/fontconfig/564b2e68ac9bc4e36a6f7f6d6125ec1c-le32d4.cache-4 30895
-var/cache/fontconfig/a48eab177a16e4f3713381162db2f3e9-le32d4.cache-4 30894
-var/cache/fontconfig/16c2fda60d1b4b719f4b3d06fd951d25-le32d4.cache-4 30893
-var/cache/fontconfig/3f589640d34b7dc9042c8d453f7c8b9c-le32d4.cache-4 30892
-var/cache/fontconfig/aec30016f93e1b46d1a973dce0d74068-le32d4.cache-4 30891
-var/cache/fontconfig/c5c45a61289222e0d30b1a26ef4effbe-le32d4.cache-4 30890
-var/cache/fontconfig/2171a34dccabdb6bcbbc728186263178-le32d4.cache-4 30889
-var/cache/fontconfig/bab58bb527bb656aaa9f116d68a48d89-le32d4.cache-4 30888
-var/cache/fontconfig/589f83ef4c36d296ce6e1c846f468f08-le32d4.cache-4 30887
-var/cache/fontconfig/f6d4eedfaab2589bde49f7a3ff831d22-le32d4.cache-4 30886
-var/cache/fontconfig/b872e6e592da6075ffa4ab0a1fcc0c75-le32d4.cache-4 30885
-var/cache/fontconfig/c57959a16110560c8d0fcea73374aeeb-le32d4.cache-4 30884
-var/cache/fontconfig/a015930274ffcd967d2ca1b57da47cc7-le32d4.cache-4 30883
-var/cache/fontconfig/4794a0821666d79190d59a36cb4f44b5-le32d4.cache-4 30882
-var/cache/fontconfig/4f3e3037c9980c83b53a9351efadef62-le32d4.cache-4 30881
-var/cache/fontconfig/660208299946a285a940457d1287da33-le32d4.cache-4 30880
-var/cache/fontconfig/14a5e22175779b556eaa434240950366-le32d4.cache-4 30879
-var/cache/fontconfig/dc05db6664285cc2f12bf69c139ae4c3-le32d4.cache-4 30878
-var/cache/fontconfig/04aabc0a78ac019cf9454389977116d2-le32d4.cache-4 30877
-var/cache/fontconfig/6d41288fd70b0be22e8c3a91e032eec0-le32d4.cache-4 30876
-var/cache/fontconfig/a6d8cf8e4ec09cdbc8633c31745a07dd-le32d4.cache-4 30870
-var/cache/fontconfig/0fafd173547752dce4dee1a69e0b3c95-le32d4.cache-4 30869
-var/cache/fontconfig/945677eb7aeaf62f1d50efc3fb3ec7d8-le32d4.cache-4 30868
-var/cache/fontconfig/6333f38776742d18e214673cd2c24e34-le32d4.cache-4 30867
-usr/lib/gnome-settings-daemon-3.0/libxrandr.so 30866
-usr/lib/gnome-settings-daemon-3.0/libsound.so 30865
-usr/lib/gnome-settings-daemon-3.0/libkeyboard.so 30864
-usr/lib/gnome-settings-daemon-3.0/liba11y-settings.so 30863
-usr/lib/gnome-settings-daemon-3.0/liba11y-keyboard.so 30862
-usr/lib/gnome-settings-daemon-3.0/libsmartcard.so 30861
-usr/lib/i386-linux-gnu/libnss3.so 30860
-usr/lib/i386-linux-gnu/libnspr4.so 30859
-usr/lib/i386-linux-gnu/libnssutil3.so 30858
-usr/lib/i386-linux-gnu/libplc4.so 30857
-usr/lib/i386-linux-gnu/libplds4.so 30856
-usr/lib/gnome-settings-daemon-3.0/libcolor.so 30855
-usr/lib/i386-linux-gnu/libcolord.so.2.0.1 30854
-usr/lib/i386-linux-gnu/libcolordprivate.so.2.0.1 30853
-usr/lib/i386-linux-gnu/liblcms2.so.2.0.6 30852
-usr/lib/gnome-settings-daemon-3.0/liborientation.so 30851
-usr/lib/gnome-settings-daemon-3.0/libmedia-keys.so 30850
-usr/lib/i386-linux-gnu/libpulse-mainloop-glib.so.0.0.5 30849
-usr/lib/gnome-settings-daemon-3.0/libclipboard.so 30848
-var/lib/polkit-1/localauthority/10-vendor.d/org.freedesktop.NetworkManager.pkla 30847
-var/lib/polkit-1/localauthority/10-vendor.d/gnome-control-center.pkla 30846
-etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.pkla 30845
-etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.cups.pkla 30844
-etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.accounts.pkla 30843
-usr/bin/metacity 30842
-usr/lib/i386-linux-gnu/libstartup-notification-1.so.0.0.0 30841
-usr/lib/libgtop-2.0.so.7.2.0 30840
-usr/lib/i386-linux-gnu/libxcb-util.so.0.0.0 30839
-lib/systemd/system/colord.service 30838
-usr/lib/i386-linux-gnu/nss/libsoftokn3.so 30837
-usr/lib/colord/colord 30836
-usr/lib/i386-linux-gnu/libsqlite3.so.0.8.6 30835
-usr/lib/i386-linux-gnu/nss/libnssdbm3.so 30834
-usr/lib/i386-linux-gnu/libgusb.so.2.0.3 30833
-usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders.cache 30832
-usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_camera.so 30831
-usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_sane.so 30830
-usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_scanner.so 30829
-usr/share/themes/Default/gtk-3.0/gtk-keys.css 30828
-usr/share/mime/mime.cache 30827
-usr/lib/i386-linux-gnu/nss/libfreeblpriv3.so 30826
-usr/share/color/icc/colord/BestRGB.icc 30825
-usr/share/X11/locale/locale.alias 30824
-usr/share/X11/locale/locale.dir 30823
-usr/share/X11/locale/en_US.UTF-8/XLC_LOCALE 30822
-sbin/agetty 30821
-usr/lib/locale/C.UTF-8/LC_CTYPE 30820
-etc/issue 30819
-usr/share/color/icc/colord/BetaRGB.icc 30818
-usr/share/color/icc/colord/BruceRGB.icc 30817
-usr/share/color/icc/colord/Crayons.icc 30816
-usr/share/color/icc/colord/DonRGB4.icc 30815
-usr/share/color/icc/colord/ECI-RGBv1.icc 30814
-usr/share/color/icc/colord/ECI-RGBv2.icc 30813
-usr/share/color/icc/colord/EktaSpacePS5.icc 30812
-usr/share/color/icc/colord/FOGRA27L_coated.icc 30811
-usr/share/color/icc/colord/FOGRA28L_webcoated.icc 30810
-usr/share/themes/Adwaita/metacity-1/metacity-theme-3.xml 30809
-usr/bin/gnome-flashback 30805
-usr/bin/pulseaudio 30804
-usr/lib/libpulsecore-5.0.so 30803
-usr/share/icons/Adwaita/cursors/left_ptr 30802
-usr/lib/i386-linux-gnu/libsamplerate.so.0.1.8 30801
-usr/bin/tails-greeter 30800
-usr/share/tails-greeter/tails-greeter.py 30799
-usr/lib/python2.7/dist-packages/gi/__init__.py 30798
-usr/lib/python2.7/pkgutil.py 30797
-usr/lib/python2.7/importlib/__init__.py 30796
-usr/share/color/icc/colord/FOGRA29L_uncoated.icc 30795
-usr/share/color/icc/colord/FOGRA30L_uncoated_yellowish.icc 30794
-usr/share/color/icc/colord/FOGRA39L_coated.icc 30793
-usr/share/color/icc/colord/FOGRA40L_SC_paper.icc 30792
-usr/share/color/icc/colord/FOGRA45L_lwc.icc 30791
-usr/share/icons/Adwaita/index.theme 30790
-usr/share/icons/gnome/index.theme 30789
-usr/lib/python2.7/dist-packages/gi/_gi.so 30788
-usr/lib/i386-linux-gnu/libgirepository-1.0.so.1.0.0 30787
-usr/lib/python2.7/dist-packages/gi/_error.py 30786
-usr/lib/python2.7/logging/__init__.py 30785
-usr/lib/python2.7/collections.py 30784
-usr/lib/python2.7/keyword.py 30783
-usr/lib/python2.7/heapq.py 30782
-usr/lib/python2.7/threading.py 30781
-usr/lib/python2.7/atexit.py 30780
-usr/lib/python2.7/logging/config.py 30779
-usr/lib/python2.7/io.py 30778
-usr/lib/python2.7/logging/handlers.py 30777
-usr/share/color/icc/colord/FOGRA47L_uncoated.icc 30776
-usr/share/color/icc/colord/GRACoL_TR006_coated.icc 30775
-usr/share/color/icc/colord/Gamma5000K.icc 30774
-usr/share/color/icc/colord/Gamma5500K.icc 30773
-usr/share/color/icc/colord/Gamma6500K.icc 30772
-usr/share/color/icc/colord/IFRA26S_2004_newsprint.icc 30771
-usr/share/icons/hicolor/index.theme 30770
-usr/share/color/icc/colord/SNAP_TR002_newsprint.icc 30769
-usr/share/color/icc/colord/SWOP_TR003_coated_3.icc 30768
-usr/share/color/icc/colord/SWOP_TR005_coated_5.icc 30767
-usr/share/color/icc/colord/WideGamutRGB.icc 30766
-usr/lib/i386-linux-gnu/sse2/libspeexdsp.so.1.5.0 30765
-usr/share/color/icc/ghostscript/default_cmyk.icc 30764
-usr/share/color/icc/ghostscript/default_gray.icc 30763
-usr/share/color/icc/ghostscript/default_rgb.icc 30762
-usr/lib/i386-linux-gnu/liborc-0.4.so.0.22.0 30761
-usr/share/color/icc/ghostscript/gray_to_k.icc 30760
-usr/share/color/icc/ghostscript/lab.icc 30759
-usr/share/color/icc/ghostscript/ps_cmyk.icc 30758
-usr/share/color/icc/ghostscript/ps_gray.icc 30757
-usr/share/color/icc/ghostscript/ps_rgb.icc 30756
-usr/share/color/icc/ghostscript/sgray.icc 30755
-usr/lib/python2.7/SocketServer.py 30754
-usr/share/color/icc/ghostscript/srgb.icc 30753
-usr/lib/i386-linux-gnu/girepository-1.0/Gtk-3.0.typelib 30752
-usr/lib/python2.7/dist-packages/gi/repository/__init__.py 30751
-usr/lib/python2.7/dist-packages/gi/importer.py 30750
-usr/lib/python2.7/dist-packages/gi/module.py 30749
-usr/lib/python2.7/dist-packages/gi/overrides/__init__.py 30748
-usr/lib/colord/colord-sane 30747
-usr/share/icons/Adwaita/16x16/status/audio-volume-muted.png 30746
-usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders/libpixbufloader-png.so 30745
-usr/share/fonts/opentype/cantarell/Cantarell-Regular.otf 30744
-usr/lib/python2.7/dist-packages/gi/_constants.py 30743
-usr/lib/i386-linux-gnu/libsane.so.1.0.24 30742
-usr/lib/python2.7/dist-packages/gi/types.py 30741
-usr/lib/python2.7/dist-packages/gi/docstring.py 30740
-usr/lib/python2.7/dist-packages/gi/_propertyhelper.py 30739
-usr/lib/python2.7/dist-packages/gi/_signalhelper.py 30738
-usr/lib/python2.7/inspect.py 30737
-usr/lib/python2.7/dis.py 30736
-etc/pulse/daemon.conf 30735
-usr/share/icons/Adwaita/16x16/status/microphone-sensitivity-muted.png 30734
-etc/sane.d/dll.d/hplip 30733
-etc/pulse/default.pa 30732
-usr/lib/pulse-5.0/modules/module-device-restore.so 30731
-usr/lib/pulse-5.0/modules/libprotocol-native.so 30730
-usr/lib/pulse-5.0/modules/module-stream-restore.so 30729
-usr/lib/pulse-5.0/modules/module-card-restore.so 30728
-usr/lib/python2.7/opcode.py 30727
-usr/lib/python2.7/tokenize.py 30726
-usr/lib/python2.7/token.py 30725
-etc/sane.d/dll.conf 30724
-usr/lib/i386-linux-gnu/sane/libsane-xerox_mfp.so.1.0.24 30723
-usr/lib/i386-linux-gnu/girepository-1.0/xlib-2.0.typelib 30722
-usr/lib/i386-linux-gnu/girepository-1.0/Gdk-3.0.typelib 30721
-usr/lib/i386-linux-gnu/girepository-1.0/cairo-1.0.typelib 30720
-etc/sane.d/xerox_mfp.conf 30719
-usr/lib/pulse-5.0/modules/module-augment-properties.so 30718
-usr/lib/i386-linux-gnu/sane/libsane-v4l.so.1.0.24 30717
-usr/lib/i386-linux-gnu/libv4l1.so.0.0.0 30716
-usr/lib/i386-linux-gnu/libv4l2.so.0.0.0 30715
-usr/lib/i386-linux-gnu/libv4lconvert.so.0.0.0 30714
-usr/lib/pulse-5.0/modules/module-switch-on-port-available.so 30713
-usr/lib/i386-linux-gnu/libjpeg.so.62.1.0 30712
-usr/lib/pulse-5.0/modules/module-udev-detect.so 30711
-etc/sane.d/v4l.conf 30710
-usr/lib/i386-linux-gnu/sane/libsane-umax1220u.so.1.0.24 30709
-etc/sane.d/umax1220u.conf 30708
-usr/lib/i386-linux-gnu/sane/libsane-umax.so.1.0.24 30707
-etc/sane.d/umax.conf 30706
-usr/lib/pulse-5.0/modules/module-alsa-card.so 30705
-usr/lib/pulse-5.0/modules/libalsa-util.so 30704
-usr/lib/i386-linux-gnu/sane/libsane-u12.so.1.0.24 30703
-usr/lib/i386-linux-gnu/girepository-1.0/Pango-1.0.typelib 30702
-usr/lib/i386-linux-gnu/girepository-1.0/GObject-2.0.typelib 30701
-usr/lib/i386-linux-gnu/girepository-1.0/GLib-2.0.typelib 30700
-usr/lib/i386-linux-gnu/girepository-1.0/Gio-2.0.typelib 30699
-usr/share/pulseaudio/alsa-mixer/profile-sets/extra-hdmi.conf 30698
-usr/share/alsa/cards/aliases.conf 30697
-usr/share/alsa/pcm/default.conf 30696
-usr/share/alsa/pcm/dmix.conf 30695
-usr/share/alsa/pcm/dsnoop.conf 30694
-usr/share/alsa/cards/HDA-Intel.conf 30693
-usr/share/alsa/pcm/front.conf 30692
-usr/lib/girepository-1.0/GdkPixbuf-2.0.typelib 30691
-usr/lib/i386-linux-gnu/girepository-1.0/GModule-2.0.typelib 30690
-usr/lib/girepository-1.0/Atk-1.0.typelib 30689
-etc/sane.d/u12.conf 30688
-usr/lib/i386-linux-gnu/sane/libsane-teco3.so.1.0.24 30687
-etc/sane.d/teco3.conf 30686
-usr/lib/python2.7/dist-packages/gi/overrides/Gtk.py 30685
-usr/lib/i386-linux-gnu/sane/libsane-teco2.so.1.0.24 30684
-etc/sane.d/teco2.conf 30683
-usr/lib/i386-linux-gnu/sane/libsane-teco1.so.1.0.24 30682
-etc/sane.d/teco1.conf 30681
-usr/lib/i386-linux-gnu/sane/libsane-tamarack.so.1.0.24 30680
-etc/sane.d/tamarack.conf 30679
-usr/lib/i386-linux-gnu/sane/libsane-sp15c.so.1.0.24 30678
-etc/sane.d/sp15c.conf 30677
-usr/lib/i386-linux-gnu/sane/libsane-snapscan.so.1.0.24 30676
-etc/sane.d/snapscan.conf 30675
-usr/lib/i386-linux-gnu/sane/libsane-sm3840.so.1.0.24 30674
-usr/lib/i386-linux-gnu/sane/libsane-sm3600.so.1.0.24 30673
-usr/lib/i386-linux-gnu/sane/libsane-sharp.so.1.0.24 30672
-usr/lib/python2.7/dist-packages/gi/overrides/GObject.py 30671
-usr/lib/python2.7/dist-packages/gi/overrides/GLib.py 30670
-usr/lib/python2.7/dist-packages/gi/_option.py 30669
-usr/share/alsa/pcm/surround21.conf 30668
-usr/share/alsa/pcm/surround40.conf 30667
-usr/share/alsa/pcm/surround41.conf 30666
-usr/share/alsa/pcm/surround50.conf 30665
-usr/share/alsa/pcm/surround51.conf 30664
-usr/share/alsa/pcm/surround71.conf 30663
-usr/share/alsa/pcm/iec958.conf 30662
-usr/share/alsa/pcm/hdmi.conf 30661
-usr/share/alsa/pcm/modem.conf 30660
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-front-mic.conf 30659
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic.conf.common 30658
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-rear-mic.conf 30657
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-internal-mic.conf 30656
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-dock-mic.conf 30655
-usr/share/pulseaudio/alsa-mixer/paths/analog-input.conf 30654
-usr/share/pulseaudio/alsa-mixer/paths/analog-input.conf.common 30653
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic.conf 30652
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-linein.conf 30651
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-aux.conf 30650
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-video.conf 30649
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-tvtuner.conf 30648
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-fm.conf 30647
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic-line.conf 30646
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-headphone-mic.conf 30645
-usr/share/pulseaudio/alsa-mixer/paths/analog-input-headset-mic.conf 30644
-etc/sane.d/sharp.conf 30643
-usr/lib/i386-linux-gnu/sane/libsane-sceptre.so.1.0.24 30642
-etc/sane.d/sceptre.conf 30641
-usr/lib/i386-linux-gnu/sane/libsane-s9036.so.1.0.24 30640
-etc/sane.d/s9036.conf 30639
-usr/lib/i386-linux-gnu/sane/libsane-rts8891.so.1.0.24 30638
-etc/sane.d/rts8891.conf 30637
-usr/lib/i386-linux-gnu/sane/libsane-ricoh.so.1.0.24 30636
-etc/sane.d/ricoh.conf 30635
-usr/lib/i386-linux-gnu/sane/libsane-qcam.so.1.0.24 30634
-etc/sane.d/qcam.conf 30633
-usr/lib/i386-linux-gnu/sane/libsane-plustek.so.1.0.24 30632
-usr/share/pulseaudio/alsa-mixer/paths/analog-output.conf 30631
-usr/share/pulseaudio/alsa-mixer/paths/analog-output.conf.common 30630
-usr/share/pulseaudio/alsa-mixer/paths/analog-output-lineout.conf 30629
-etc/sane.d/plustek.conf 30628
-usr/lib/i386-linux-gnu/sane/libsane-pixma.so.1.0.24 30627
-etc/sane.d/pixma.conf 30626
-usr/share/pulseaudio/alsa-mixer/paths/analog-output-speaker.conf 30625
-usr/share/pulseaudio/alsa-mixer/paths/analog-output-desktop-speaker.conf 30624
-usr/share/pulseaudio/alsa-mixer/paths/analog-output-headphones.conf 30623
-usr/share/pulseaudio/alsa-mixer/paths/analog-output-headphones-2.conf 30622
-usr/lib/pulse-5.0/modules/module-native-protocol-unix.so 30621
-usr/lib/pulse-5.0/modules/module-default-device-restore.so 30620
-usr/lib/pulse-5.0/modules/module-rescue-streams.so 30619
-usr/lib/python2.7/dist-packages/tailsgreeter/__init__.py 30618
-usr/lib/python2.7/dist-packages/tailsgreeter/errors.py 30617
-usr/lib/python2.7/dist-packages/tailsgreeter/gdmclient.py 30616
-usr/lib/pulse-5.0/modules/module-always-sink.so 30615
-usr/lib/girepository-1.0/Gdm-1.0.typelib 30614
-usr/lib/pulse-5.0/modules/module-intended-roles.so 30613
-usr/lib/pulse-5.0/modules/module-suspend-on-idle.so 30612
-usr/lib/python2.7/dist-packages/tailsgreeter/config.py 30611
-usr/lib/python2.7/ConfigParser.py 30610
-usr/lib/pulse-5.0/modules/module-console-kit.so 30609
-usr/lib/pulse-5.0/modules/module-systemd-login.so 30608
-usr/share/tails-greeter/tails-logging.conf 30607
-usr/lib/python2.7/pipes.py 30606
-usr/lib/python2.7/tempfile.py 30605
-usr/lib/python2.7/dist-packages/tailsgreeter/rootaccess.py 30604
-usr/lib/python2.7/dist-packages/tailsgreeter/persistence.py 30603
-usr/lib/python2.7/subprocess.py 30602
-usr/lib/python2.7/pickle.py 30601
-usr/lib/python2.7/dist-packages/tailsgreeter/utils.py 30600
-usr/lib/python2.7/dist-packages/tailsgreeter/physicalsecurity.py 30599
-usr/lib/python2.7/dist-packages/tailsgreeter/language.py 30598
-usr/lib/python2.7/dist-packages/pycountry/__init__.py 30597
-usr/lib/python2.7/dist-packages/pycountry/db.py 30596
-usr/lib/python2.7/xml/__init__.py 30595
-usr/lib/python2.7/xml/dom/__init__.py 30594
-usr/lib/python2.7/xml/dom/domreg.py 30593
-usr/lib/python2.7/xml/dom/minicompat.py 30592
-usr/lib/python2.7/xml/dom/minidom.py 30591
-usr/lib/pulse-5.0/modules/module-position-event-sounds.so 30590
-usr/lib/python2.7/xml/dom/xmlbuilder.py 30589
-usr/lib/pulse-5.0/modules/module-role-cork.so 30588
-usr/lib/python2.7/xml/dom/NodeFilter.py 30587
-usr/lib/pulse-5.0/modules/module-filter-heuristics.so 30586
-usr/lib/python2.7/dist-packages/pkg_resources.py 30585
-usr/lib/pulse-5.0/modules/module-filter-apply.so 30584
-usr/share/tails/desktop_wallpaper.png 30583
-usr/lib/python2.7/zipfile.py 30582
-usr/lib/python2.7/shutil.py 30581
-usr/lib/python2.7/fnmatch.py 30580
-lib/systemd/system/systemd-localed.service 30579
-usr/lib/python2.7/symbol.py 30578
-usr/lib/python2.7/platform.py 30577
-lib/systemd/systemd-localed 30576
-usr/lib/python2.7/plistlib.py 30575
-usr/lib/python2.7/email/__init__.py 30574
-usr/share/icons/Adwaita/16x16/status/audio-volume-medium.png 30573
-usr/lib/python2.7/email/mime/__init__.py 30572
-usr/lib/python2.7/email/parser.py 30571
-usr/lib/python2.7/email/feedparser.py 30570
-usr/lib/i386-linux-gnu/sane/libsane-pie.so.1.0.24 30569
-usr/lib/python2.7/email/errors.py 30568
-usr/lib/python2.7/email/message.py 30567
-etc/sane.d/pie.conf 30566
-usr/lib/dconf/dconf-service 30565
-usr/lib/i386-linux-gnu/sane/libsane-niash.so.1.0.24 30564
-usr/lib/python2.7/uu.py 30563
-usr/lib/python2.7/email/charset.py 30562
-usr/lib/python2.7/email/base64mime.py 30561
-usr/lib/python2.7/email/utils.py 30560
-usr/lib/i386-linux-gnu/sane/libsane-nec.so.1.0.24 30559
-usr/lib/python2.7/base64.py 30558
-etc/sane.d/nec.conf 30557
-usr/lib/i386-linux-gnu/sane/libsane-mustek_usb2.so.1.0.24 30556
-usr/lib/python2.7/urllib.py 30555
-usr/lib/i386-linux-gnu/sane/libsane-mustek_usb.so.1.0.24 30554
-usr/share/icons/Adwaita/16x16/status/microphone-sensitivity-high.png 30553
-etc/sane.d/mustek_usb.conf 30552
-usr/lib/i386-linux-gnu/sane/libsane-mustek.so.1.0.24 30551
-usr/lib/i386-linux-gnu/libieee1284.so.3.2.2 30550
-etc/sane.d/mustek.conf 30549
-usr/lib/i386-linux-gnu/sane/libsane-microtek2.so.1.0.24 30548
-etc/sane.d/microtek2.conf 30547
-usr/lib/i386-linux-gnu/sane/libsane-microtek.so.1.0.24 30546
-etc/sane.d/microtek.conf 30545
-usr/lib/i386-linux-gnu/sane/libsane-matsushita.so.1.0.24 30544
-etc/sane.d/matsushita.conf 30543
-usr/lib/i386-linux-gnu/sane/libsane-magicolor.so.1.0.24 30542
-etc/sane.d/magicolor.conf 30541
-usr/lib/i386-linux-gnu/sane/libsane-ma1509.so.1.0.24 30540
-etc/sane.d/ma1509.conf 30539
-usr/lib/i386-linux-gnu/sane/libsane-lexmark.so.1.0.24 30538
-etc/sane.d/lexmark.conf 30537
-usr/lib/i386-linux-gnu/sane/libsane-leo.so.1.0.24 30536
-etc/sane.d/leo.conf 30535
-usr/lib/i386-linux-gnu/sane/libsane-kvs20xx.so.1.0.24 30534
-usr/lib/i386-linux-gnu/sane/libsane-kvs1025.so.1.0.24 30533
-usr/lib/i386-linux-gnu/sane/libsane-kodakaio.so.1.0.24 30532
-usr/lib/python2.7/urlparse.py 30531
-usr/lib/python2.7/ssl.py 30530
-usr/lib/i386-linux-gnu/libavahi-common.so.3.5.3 30529
-usr/lib/i386-linux-gnu/libavahi-client.so.3.2.9 30528
-etc/sane.d/kodakaio.conf 30527
-usr/lib/i386-linux-gnu/sane/libsane-kodak.so.1.0.24 30526
-etc/sane.d/kodak.conf 30525
-usr/lib/i386-linux-gnu/sane/libsane-ibm.so.1.0.24 30524
-etc/sane.d/ibm.conf 30523
-usr/lib/i386-linux-gnu/sane/libsane-hs2p.so.1.0.24 30522
-etc/sane.d/hs2p.conf 30521
-usr/lib/i386-linux-gnu/sane/libsane-hpljm1005.so.1.0.24 30520
-usr/lib/i386-linux-gnu/sane/libsane-hp5590.so.1.0.24 30519
-usr/lib/python2.7/contextlib.py 30518
-usr/lib/python2.7/email/_parseaddr.py 30517
-usr/lib/python2.7/calendar.py 30516
-usr/lib/python2.7/quopri.py 30515
-usr/lib/python2.7/email/encoders.py 30514
-usr/lib/python2.7/email/quoprimime.py 30513
-usr/lib/python2.7/email/iterators.py 30512
-usr/lib/i386-linux-gnu/sane/libsane-hp5400.so.1.0.24 30511
-usr/lib/python2.7/lib-dynload/parser.i386-linux-gnu.so 30510
-etc/sane.d/hp5400.conf 30509
-usr/lib/i386-linux-gnu/sane/libsane-hp4200.so.1.0.24 30508
-etc/sane.d/hp4200.conf 30507
-usr/lib/i386-linux-gnu/sane/libsane-hp3500.so.1.0.24 30506
-usr/lib/python2.7/dist-packages/matplotlib-1.4.2.egg-info/namespace_packages.txt 30505
-usr/lib/python2.7/dist-packages/protobuf-2.6.1.egg-info/namespace_packages.txt 30504
-usr/share/xml/iso-codes/iso_3166.xml 30503
-usr/lib/python2.7/xml/dom/expatbuilder.py 30502
-usr/lib/python2.7/xml/parsers/__init__.py 30501
-usr/lib/i386-linux-gnu/sane/libsane-hpsj5s.so.1.0.24 30500
-usr/lib/python2.7/xml/parsers/expat.py 30499
-etc/sane.d/hpsj5s.conf 30498
-usr/lib/i386-linux-gnu/sane/libsane-hp3900.so.1.0.24 30497
-usr/lib/i386-linux-gnu/libtiff.so.5.2.0 30496
-usr/lib/python2.7/lib-dynload/pyexpat.i386-linux-gnu.so 30495
-usr/lib/i386-linux-gnu/libjbig.so.0 30494
-etc/sane.d/hp3900.conf 30493
-usr/lib/i386-linux-gnu/sane/libsane-hp.so.1.0.24 30492
-etc/sane.d/hp.conf 30491
-usr/lib/i386-linux-gnu/sane/libsane-gt68xx.so.1.0.24 30490
-etc/sane.d/gt68xx.conf 30489
-usr/share/xml/iso-codes/iso_15924.xml 30488
-usr/lib/i386-linux-gnu/sane/libsane-genesys.so.1.0.24 30487
-etc/sane.d/genesys.conf 30486
-usr/lib/i386-linux-gnu/sane/libsane-fujitsu.so.1.0.24 30485
-etc/sane.d/fujitsu.conf 30484
-usr/lib/i386-linux-gnu/sane/libsane-epson2.so.1.0.24 30483
-etc/sane.d/epson2.conf 30482
-usr/share/xml/iso-codes/iso_4217.xml 30481
-usr/share/xml/iso-codes/iso_639.xml 30480
-usr/share/xml/iso-codes/iso_3166_2.xml 30479
-usr/lib/python2.7/dist-packages/icu.py 30478
-usr/lib/python2.7/dist-packages/icu_docs.py 30477
-usr/lib/python2.7/dist-packages/_icu.so 30476
-usr/lib/i386-linux-gnu/libicui18n.so.52.1 30475
-usr/lib/i386-linux-gnu/libicuuc.so.52.1 30474
-usr/lib/i386-linux-gnu/libicudata.so.52.1 30473
-usr/lib/i386-linux-gnu/sane/libsane-epjitsu.so.1.0.24 30472
-etc/sane.d/epjitsu.conf 30471
-usr/lib/i386-linux-gnu/sane/libsane-dmc.so.1.0.24 30470
-etc/sane.d/dmc.conf 30469
-usr/lib/i386-linux-gnu/sane/libsane-dell1600n_net.so.1.0.24 30468
-etc/sane.d/dell1600n_net.conf 30467
-usr/lib/i386-linux-gnu/sane/libsane-coolscan3.so.1.0.24 30466
-etc/sane.d/coolscan3.conf 30465
-usr/lib/i386-linux-gnu/sane/libsane-coolscan.so.1.0.24 30464
-etc/sane.d/coolscan.conf 30463
-usr/lib/i386-linux-gnu/sane/libsane-cardscan.so.1.0.24 30462
-etc/sane.d/cardscan.conf 30461
-usr/lib/i386-linux-gnu/sane/libsane-canon_dr.so.1.0.24 30460
-etc/sane.d/canon_dr.conf 30459
-usr/lib/i386-linux-gnu/sane/libsane-canon630u.so.1.0.24 30458
-etc/sane.d/canon630u.conf 30457
-usr/lib/i386-linux-gnu/sane/libsane-canon.so.1.0.24 30456
-etc/sane.d/canon.conf 30455
-usr/lib/i386-linux-gnu/sane/libsane-bh.so.1.0.24 30454
-etc/sane.d/bh.conf 30453
-usr/lib/i386-linux-gnu/sane/libsane-as6e.so.1.0.24 30452
-usr/lib/i386-linux-gnu/sane/libsane-artec_eplus48u.so.1.0.24 30451
-etc/sane.d/artec_eplus48u.conf 30450
-usr/lib/i386-linux-gnu/sane/libsane-artec.so.1.0.24 30449
-etc/sane.d/artec.conf 30448
-usr/lib/i386-linux-gnu/sane/libsane-avision.so.1.0.24 30447
-etc/sane.d/avision.conf 30446
-usr/lib/i386-linux-gnu/sane/libsane-apple.so.1.0.24 30445
-etc/sane.d/apple.conf 30444
-usr/lib/i386-linux-gnu/sane/libsane-agfafocus.so.1.0.24 30443
-etc/sane.d/agfafocus.conf 30442
-usr/lib/i386-linux-gnu/sane/libsane-abaton.so.1.0.24 30441
-etc/sane.d/abaton.conf 30440
-usr/lib/i386-linux-gnu/sane/libsane-net.so.1.0.24 30439
-etc/sane.d/net.conf 30438
-usr/lib/i386-linux-gnu/sane/libsane-hpaio.so.1.0.0 30437
-usr/lib/i386-linux-gnu/libhpip.so.0.0.1 30436
-usr/lib/i386-linux-gnu/libhpmud.so.0.0.6 30435
-usr/lib/i386-linux-gnu/libcups.so.2 30434
-usr/lib/i386-linux-gnu/libicule.so.52.1 30433
-usr/lib/i386-linux-gnu/libhpdiscovery.so.0.0.1 30432
-usr/lib/i386-linux-gnu/libnetsnmp.so.30.0.2 30431
-usr/lib/i386-linux-gnu/libgssapi_krb5.so.2.2 30430
-usr/lib/i386-linux-gnu/libkrb5.so.3.3 30429
-usr/lib/i386-linux-gnu/libk5crypto.so.3.1 30428
-lib/i386-linux-gnu/libcom_err.so.2.1 30427
-usr/lib/i386-linux-gnu/libkrb5support.so.0.1 30426
-lib/i386-linux-gnu/libkeyutils.so.1.5 30425
-usr/share/zoneinfo/Africa/Timbuktu 30424
-usr/share/zoneinfo/Africa/Accra 30423
-usr/share/zoneinfo/Indian/Antananarivo 30422
-usr/share/zoneinfo/Africa/Algiers 30421
-usr/share/zoneinfo/Africa/Bangui 30420
-usr/share/zoneinfo/Africa/Bissau 30419
-usr/share/zoneinfo/Africa/Blantyre 30418
-usr/share/zoneinfo/Egypt 30417
-usr/share/zoneinfo/Africa/Casablanca 30416
-usr/share/zoneinfo/Africa/Ceuta 30415
-usr/share/zoneinfo/Africa/El_Aaiun 30414
-usr/share/zoneinfo/Africa/Mbabane 30413
-usr/share/zoneinfo/Africa/Juba 30412
-usr/share/zoneinfo/Africa/Monrovia 30411
-usr/share/zoneinfo/Africa/Ndjamena 30410
-usr/share/zoneinfo/Libya 30409
-usr/share/zoneinfo/Africa/Tunis 30408
-usr/share/zoneinfo/Africa/Windhoek 30407
-usr/share/zoneinfo/US/Aleutian 30406
-usr/share/zoneinfo/US/Alaska 30405
-usr/share/zoneinfo/America/Marigot 30404
-usr/share/zoneinfo/America/Araguaina 30403
-usr/share/zoneinfo/America/Buenos_Aires 30402
-usr/share/zoneinfo/America/Catamarca 30401
-usr/share/zoneinfo/America/Cordoba 30400
-usr/share/zoneinfo/America/Jujuy 30399
-usr/share/zoneinfo/America/Argentina/La_Rioja 30398
-usr/share/zoneinfo/America/Mendoza 30397
-usr/share/zoneinfo/America/Argentina/Rio_Gallegos 30396
-usr/share/zoneinfo/America/Argentina/Salta 30395
-usr/share/zoneinfo/America/Argentina/San_Juan 30394
-usr/share/zoneinfo/America/Argentina/San_Luis 30393
-usr/share/zoneinfo/America/Argentina/Tucuman 30392
-usr/share/zoneinfo/America/Argentina/Ushuaia 30391
-usr/share/zoneinfo/America/Curacao 30390
-usr/share/zoneinfo/America/Asuncion 30389
-usr/share/zoneinfo/America/Atikokan 30388
-usr/share/zoneinfo/America/Bahia 30387
-usr/share/zoneinfo/America/Bahia_Banderas 30386
-usr/share/zoneinfo/America/Barbados 30385
-usr/share/zoneinfo/America/Belem 30384
-usr/share/zoneinfo/America/Belize 30383
-usr/share/zoneinfo/America/Blanc-Sablon 30382
-usr/share/zoneinfo/America/Boa_Vista 30381
-usr/share/zoneinfo/America/Bogota 30380
-usr/share/zoneinfo/America/Boise 30379
-usr/share/zoneinfo/America/Cambridge_Bay 30378
-usr/share/zoneinfo/America/Campo_Grande 30377
-usr/share/zoneinfo/America/Cancun 30376
-usr/share/zoneinfo/America/Caracas 30375
-usr/share/zoneinfo/America/Cayenne 30374
-usr/share/zoneinfo/America/Panama 30373
-usr/share/zoneinfo/US/Central 30372
-usr/share/zoneinfo/America/Chihuahua 30371
-usr/share/zoneinfo/America/Costa_Rica 30370
-usr/share/zoneinfo/America/Creston 30369
-usr/share/zoneinfo/America/Cuiaba 30368
-usr/share/zoneinfo/America/Danmarkshavn 30367
-usr/share/zoneinfo/America/Dawson 30366
-usr/share/zoneinfo/America/Dawson_Creek 30365
-usr/share/zoneinfo/Navajo 30364
-usr/share/zoneinfo/US/Michigan 30363
-usr/share/zoneinfo/America/Edmonton 30362
-usr/share/zoneinfo/America/Eirunepe 30361
-usr/share/zoneinfo/America/El_Salvador 30360
-usr/share/zoneinfo/Mexico/BajaNorte 30359
-usr/share/zoneinfo/America/Fort_Nelson 30358
-usr/share/zoneinfo/US/East-Indiana 30357
-usr/share/zoneinfo/America/Fortaleza 30356
-usr/share/zoneinfo/America/Glace_Bay 30355
-usr/share/zoneinfo/America/Godthab 30354
-usr/share/zoneinfo/America/Goose_Bay 30353
-usr/share/zoneinfo/America/Grand_Turk 30352
-usr/share/zoneinfo/America/Guatemala 30351
-usr/share/zoneinfo/America/Guayaquil 30350
-usr/share/zoneinfo/America/Guyana 30349
-usr/share/zoneinfo/America/Halifax 30348
-usr/share/zoneinfo/Cuba 30347
-usr/share/zoneinfo/America/Hermosillo 30346
-usr/share/zoneinfo/US/Indiana-Starke 30345
-usr/share/zoneinfo/America/Indiana/Marengo 30344
-usr/share/zoneinfo/America/Indiana/Petersburg 30343
-usr/share/zoneinfo/America/Indiana/Tell_City 30342
-usr/share/zoneinfo/America/Indiana/Vevay 30341
-usr/share/zoneinfo/America/Indiana/Vincennes 30340
-usr/share/zoneinfo/America/Indiana/Winamac 30339
-usr/share/zoneinfo/America/Inuvik 30338
-usr/share/zoneinfo/America/Iqaluit 30337
-usr/share/zoneinfo/Jamaica 30336
-usr/share/zoneinfo/America/Juneau 30335
-usr/share/zoneinfo/America/Louisville 30334
-usr/share/zoneinfo/America/Kentucky/Monticello 30333
-usr/share/zoneinfo/America/La_Paz 30332
-usr/share/zoneinfo/America/Lima 30331
-usr/share/zoneinfo/US/Pacific 30330
-usr/share/zoneinfo/America/Maceio 30329
-usr/share/zoneinfo/America/Managua 30328
-usr/share/zoneinfo/Brazil/West 30327
-usr/share/zoneinfo/America/Martinique 30326
-usr/share/zoneinfo/America/Matamoros 30325
-usr/share/zoneinfo/Mexico/BajaSur 30324
-usr/share/zoneinfo/America/Menominee 30323
-usr/share/zoneinfo/America/Merida 30322
-usr/share/zoneinfo/America/Metlakatla 30321
-usr/share/zoneinfo/Mexico/General 30320
-usr/share/zoneinfo/America/Miquelon 30319
-usr/share/zoneinfo/America/Moncton 30318
-usr/share/zoneinfo/America/Monterrey 30317
-usr/share/zoneinfo/America/Montevideo 30316
-usr/share/zoneinfo/America/Toronto 30315
-usr/share/zoneinfo/America/Nassau 30314
-usr/share/zoneinfo/posixrules 30313
-usr/share/zoneinfo/America/Nipigon 30312
-usr/share/zoneinfo/America/Nome 30311
-usr/share/zoneinfo/Brazil/DeNoronha 30310
-usr/share/zoneinfo/America/North_Dakota/Beulah 30309
-usr/share/zoneinfo/America/North_Dakota/Center 30308
-usr/share/zoneinfo/America/North_Dakota/New_Salem 30307
-usr/share/zoneinfo/America/Ojinaga 30306
-usr/share/zoneinfo/America/Pangnirtung 30305
-usr/share/zoneinfo/America/Paramaribo 30304
-usr/share/zoneinfo/US/Arizona 30303
-usr/share/zoneinfo/America/Port-au-Prince 30302
-usr/share/zoneinfo/Brazil/Acre 30301
-usr/share/zoneinfo/America/Porto_Velho 30300
-usr/share/zoneinfo/America/Puerto_Rico 30299
-usr/share/zoneinfo/America/Rainy_River 30298
-usr/share/zoneinfo/America/Rankin_Inlet 30297
-usr/share/zoneinfo/America/Recife 30296
-usr/share/zoneinfo/America/Regina 30295
-usr/share/zoneinfo/America/Resolute 30294
-usr/share/zoneinfo/America/Santarem 30293
-usr/share/zoneinfo/America/Santiago 30292
-usr/share/zoneinfo/America/Santo_Domingo 30291
-usr/share/zoneinfo/Brazil/East 30290
-usr/share/zoneinfo/America/Scoresbysund 30289
-usr/share/zoneinfo/America/Sitka 30288
-usr/share/zoneinfo/America/St_Johns 30287
-usr/share/zoneinfo/America/Swift_Current 30286
-usr/share/zoneinfo/America/Tegucigalpa 30285
-usr/share/zoneinfo/America/Thule 30284
-usr/share/zoneinfo/America/Thunder_Bay 30283
-usr/share/zoneinfo/America/Vancouver 30282
-usr/share/zoneinfo/America/Whitehorse 30281
-usr/share/zoneinfo/America/Winnipeg 30280
-usr/share/zoneinfo/America/Yakutat 30279
-usr/share/zoneinfo/America/Yellowknife 30278
-usr/share/zoneinfo/Antarctica/Casey 30277
-usr/share/zoneinfo/Antarctica/Davis 30276
-usr/share/zoneinfo/Antarctica/DumontDUrville 30275
-usr/share/zoneinfo/Antarctica/Macquarie 30274
-usr/share/zoneinfo/Antarctica/Mawson 30273
-usr/share/zoneinfo/NZ 30272
-usr/share/zoneinfo/Antarctica/Palmer 30271
-usr/share/zoneinfo/Antarctica/Rothera 30270
-usr/share/zoneinfo/Antarctica/Syowa 30269
-usr/share/zoneinfo/Antarctica/Troll 30268
-usr/share/zoneinfo/Antarctica/Vostok 30267
-usr/share/zoneinfo/Europe/Oslo 30266
-usr/share/zoneinfo/Asia/Aden 30265
-usr/share/zoneinfo/Asia/Almaty 30264
-usr/share/zoneinfo/Asia/Amman 30263
-usr/share/zoneinfo/Asia/Anadyr 30262
-usr/share/zoneinfo/Asia/Aqtau 30261
-usr/share/zoneinfo/Asia/Aqtobe 30260
-usr/share/zoneinfo/Asia/Ashgabat 30259
-usr/share/zoneinfo/Asia/Baghdad 30258
-usr/share/zoneinfo/Asia/Qatar 30257
-usr/share/zoneinfo/Asia/Baku 30256
-usr/share/zoneinfo/Asia/Bangkok 30255
-usr/share/zoneinfo/Asia/Barnaul 30254
-usr/share/zoneinfo/Asia/Beirut 30253
-usr/share/zoneinfo/Asia/Bishkek 30252
-usr/share/zoneinfo/Asia/Brunei 30251
-usr/share/zoneinfo/Asia/Kolkata 30250
-usr/share/zoneinfo/Asia/Chita 30249
-usr/share/zoneinfo/Asia/Choibalsan 30248
-usr/share/zoneinfo/PRC 30247
-usr/share/zoneinfo/Asia/Colombo 30246
-usr/share/zoneinfo/Asia/Dacca 30245
-usr/share/zoneinfo/Asia/Damascus 30244
-usr/share/zoneinfo/Asia/Dili 30243
-usr/share/zoneinfo/Asia/Muscat 30242
-usr/share/zoneinfo/Asia/Dushanbe 30241
-usr/share/zoneinfo/Asia/Gaza 30240
-usr/share/zoneinfo/Asia/Hebron 30239
-usr/share/zoneinfo/Asia/Saigon 30238
-usr/share/zoneinfo/Hongkong 30237
-usr/share/zoneinfo/Asia/Hovd 30236
-usr/share/zoneinfo/Asia/Irkutsk 30235
-usr/share/zoneinfo/Turkey 30234
-usr/share/zoneinfo/Asia/Jakarta 30233
-usr/share/zoneinfo/Asia/Jayapura 30232
-usr/share/zoneinfo/Israel 30231
-usr/share/zoneinfo/Asia/Kabul 30230
-usr/share/zoneinfo/Asia/Kamchatka 30229
-usr/share/zoneinfo/Asia/Karachi 30228
-usr/share/zoneinfo/Asia/Urumqi 30227
-usr/share/zoneinfo/Asia/Kathmandu 30226
-usr/share/zoneinfo/Asia/Khandyga 30225
-usr/share/zoneinfo/Asia/Krasnoyarsk 30224
-usr/share/zoneinfo/Asia/Kuala_Lumpur 30223
-usr/share/zoneinfo/Asia/Kuching 30222
-usr/share/zoneinfo/Asia/Macao 30221
-usr/share/zoneinfo/Asia/Magadan 30220
-usr/share/zoneinfo/Asia/Makassar 30219
-usr/share/zoneinfo/Asia/Manila 30218
-usr/share/zoneinfo/Europe/Nicosia 30217
-usr/share/zoneinfo/Asia/Novokuznetsk 30216
-usr/share/zoneinfo/Asia/Novosibirsk 30215
-usr/share/zoneinfo/Asia/Omsk 30214
-usr/share/zoneinfo/Asia/Oral 30213
-usr/share/zoneinfo/Asia/Pontianak 30212
-usr/share/zoneinfo/Asia/Pyongyang 30211
-usr/share/zoneinfo/Asia/Qyzylorda 30210
-usr/share/zoneinfo/Asia/Rangoon 30209
-usr/share/zoneinfo/Asia/Sakhalin 30208
-usr/share/zoneinfo/Asia/Samarkand 30207
-usr/share/zoneinfo/ROK 30206
-usr/share/zoneinfo/Singapore 30205
-usr/share/zoneinfo/Asia/Srednekolymsk 30204
-usr/share/zoneinfo/ROC 30203
-usr/share/zoneinfo/Asia/Tashkent 30202
-usr/share/zoneinfo/Asia/Tbilisi 30201
-usr/share/zoneinfo/Iran 30200
-usr/share/zoneinfo/Asia/Thimbu 30199
-usr/share/zoneinfo/Japan 30198
-usr/share/zoneinfo/Asia/Tomsk 30197
-usr/share/zoneinfo/Asia/Ulan_Bator 30196
-usr/share/zoneinfo/Asia/Ust-Nera 30195
-usr/share/zoneinfo/Asia/Vladivostok 30194
-usr/share/zoneinfo/Asia/Yakutsk 30193
-usr/share/zoneinfo/Asia/Yekaterinburg 30192
-usr/share/zoneinfo/Asia/Yerevan 30191
-usr/share/zoneinfo/Atlantic/Azores 30190
-usr/share/zoneinfo/Atlantic/Bermuda 30189
-usr/share/zoneinfo/Atlantic/Canary 30188
-usr/share/zoneinfo/Atlantic/Cape_Verde 30187
-usr/share/zoneinfo/Atlantic/Faroe 30186
-usr/share/zoneinfo/Atlantic/Madeira 30185
-usr/share/zoneinfo/Iceland 30184
-usr/share/zoneinfo/Atlantic/South_Georgia 30183
-usr/share/zoneinfo/Atlantic/Stanley 30182
-usr/share/zoneinfo/Australia/Canberra 30181
-usr/share/zoneinfo/Australia/Adelaide 30180
-usr/share/zoneinfo/Australia/Queensland 30179
-usr/share/zoneinfo/Australia/Broken_Hill 30178
-usr/share/zoneinfo/Australia/Currie 30177
-usr/share/zoneinfo/Australia/North 30176
-usr/share/zoneinfo/Australia/Eucla 30175
-usr/share/zoneinfo/Australia/Tasmania 30174
-usr/share/zoneinfo/Australia/LHI 30173
-usr/share/zoneinfo/Australia/Lindeman 30172
-usr/share/zoneinfo/Australia/Melbourne 30171
-usr/share/zoneinfo/Australia/Perth 30170
-usr/share/zoneinfo/CET 30169
-usr/share/zoneinfo/CST6CDT 30168
-usr/share/zoneinfo/Pacific/Easter 30167
-usr/share/zoneinfo/EET 30166
-usr/share/zoneinfo/EST 30165
-usr/share/zoneinfo/EST5EDT 30164
-usr/share/zoneinfo/Eire 30163
-usr/share/zoneinfo/GMT-0 30162
-usr/share/zoneinfo/Etc/GMT+1 30161
-usr/share/zoneinfo/Etc/GMT+10 30160
-usr/share/zoneinfo/Etc/GMT+11 30159
-usr/share/zoneinfo/Etc/GMT+12 30158
-usr/share/zoneinfo/Etc/GMT+2 30157
-usr/share/zoneinfo/Etc/GMT+3 30156
-usr/share/zoneinfo/Etc/GMT+4 30155
-usr/share/zoneinfo/Etc/GMT+5 30154
-usr/share/zoneinfo/Etc/GMT+6 30153
-usr/share/zoneinfo/Etc/GMT+7 30152
-usr/share/zoneinfo/Etc/GMT+8 30151
-usr/share/zoneinfo/Etc/GMT+9 30150
-usr/share/zoneinfo/Etc/GMT-1 30149
-usr/share/zoneinfo/Etc/GMT-10 30148
-usr/share/zoneinfo/Etc/GMT-11 30147
-usr/share/zoneinfo/Etc/GMT-12 30146
-usr/share/zoneinfo/Etc/GMT-13 30145
-usr/share/zoneinfo/Etc/GMT-14 30144
-usr/share/zoneinfo/Etc/GMT-2 30143
-usr/share/zoneinfo/Etc/GMT-3 30142
-usr/share/zoneinfo/Etc/GMT-4 30141
-usr/share/zoneinfo/Etc/GMT-5 30140
-usr/share/zoneinfo/Etc/GMT-6 30139
-usr/share/zoneinfo/Etc/GMT-7 30138
-usr/share/zoneinfo/Etc/GMT-8 30137
-usr/share/zoneinfo/Etc/GMT-9 30136
-usr/share/zoneinfo/UCT 30135
-usr/lib/python2.7/dist-packages/gi/overrides/Gdk.py 30134
-usr/lib/i386-linux-gnu/girepository-1.0/GdkX11-3.0.typelib 30133
-usr/lib/girepository-1.0/Xkl-1.0.typelib 30132
-usr/lib/girepository-1.0/AccountsService-1.0.typelib 30131
-usr/share/tails-greeter/default_langcodes 30130
-usr/share/tails-greeter/language_codes 30129
-usr/lib/libxklavier.so.16.2.0 30128
-usr/share/X11/xkb/rules/evdev.lst 30127
-usr/share/X11/xkb/rules/evdev.xml 30126
-usr/lib/python2.7/dist-packages/tailsgreeter/langpanel.py 30125
-usr/lib/python2.7/dist-packages/tailsgreeter/persistencewindow.py 30124
-usr/lib/python2.7/dist-packages/tailsgreeter/helpwindow.py 30123
-usr/lib/python2.7/webbrowser.py 30122
-usr/lib/python2.7/shlex.py 30121
-usr/lib/i386-linux-gnu/girepository-1.0/WebKit-3.0.typelib 30120
-usr/lib/girepository-1.0/Soup-2.4.typelib 30119
-usr/lib/i386-linux-gnu/girepository-1.0/JavaScriptCore-3.0.typelib 30118
-usr/lib/python2.7/dist-packages/tailsgreeter/optionswindow.py 30117
-usr/lib/i386-linux-gnu/libgdm.so.1.0.0 30116
-usr/lib/python2.7/dist-packages/gi/overrides/Gio.py 30115
-usr/share/tails-greeter/glade/langpanel.glade 30114
-usr/share/locale/en/LC_MESSAGES/tails-greeter.mo 30113
-usr/share/icons/Adwaita/16x16/categories/applications-internet.png 30112
-usr/share/fonts/truetype/dejavu/DejaVuSans.ttf 30111
-usr/share/fonts/truetype/unfonts-core/UnDotum.ttf 30110
-usr/share/icons/Adwaita/scalable/actions/pan-down-symbolic.svg 30109
-usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders/libpixbufloader-svg.so 30108
-usr/lib/i386-linux-gnu/librsvg-2.so.2.40.5 30107
-usr/lib/i386-linux-gnu/libcroco-0.6.so.3.0.1 30106
-usr/share/icons/Adwaita/16x16/apps/preferences-desktop-locale.png 30105
-usr/share/icons/Adwaita/16x16/apps/preferences-desktop-keyboard.png 30104
-usr/share/tails-greeter/glade/persistencewindow.glade 30103
-usr/local/sbin/live-persist 30102
-lib/live/boot/9990-cmdline-old 30101
-lib/live/boot/9990-misc-helpers.sh 30100
-sbin/cryptsetup 30098
-lib/i386-linux-gnu/libcryptsetup.so.4.6.0 30097
-lib/i386-linux-gnu/libpopt.so.0.0.0 30096
-usr/share/tails-greeter/glade/optionswindow.glade 30095
-usr/lib/i386-linux-gnu/gtk-3.0/3.0.0/immodules.cache 30094
-usr/lib/i386-linux-gnu/gtk-3.0/3.0.0/immodules/im-ibus.so 30093
-usr/lib/i386-linux-gnu/libibus-1.0.so.5.0.509 30092
-usr/share/icons/Adwaita/16x16/status/dialog-warning.png 30091
-usr/share/fonts/opentype/cantarell/Cantarell-Bold.otf 30090
-usr/lib/i386-linux-gnu/gconv/ISO8859-1.so 30089
-usr/share/icons/Adwaita/256x256/status/image-missing.png 30088
-usr/share/icons/Adwaita/16x16/status/image-missing.png 30087
-usr/share/icons/Adwaita/cursors/watch 30086
-etc/pam.d/gdm-autologin 30085
-lib/i386-linux-gnu/security/pam_succeed_if.so 30084
-lib/i386-linux-gnu/security/pam_selinux.so 30083
-lib/i386-linux-gnu/security/pam_loginuid.so 30082
-etc/gdm3/PostLogin/Default 30081
-etc/live/config.d/username.conf 30080
-usr/local/lib/tails-unblock-network 30079
-lib/systemd/system/tails-unblock-network.service 30078
-usr/bin/localectl 30077
-usr/local/sbin/tails-additional-software 30076
-usr/bin/env 30075
-usr/lib/python2.7/encodings/ascii.py 30074
-bin/sync 30073
-usr/sbin/deluser 30072
-usr/share/perl/5.20.2/File/Find.pm 30071
-usr/share/perl/5.20.2/File/Basename.pm 30070
-usr/share/perl/5.20.2/File/Temp.pm 30069
-usr/share/perl/5.20.2/File/Path.pm 30068
-usr/lib/i386-linux-gnu/perl/5.20.2/Errno.pm 30067
-usr/share/perl/5.20.2/parent.pm 30066
-usr/share/perl/5.20.2/Carp/Heavy.pm 30065
-etc/deluser.conf 30064
-usr/bin/passwd 30063
-usr/local/lib/tails-shell-library/tails-greeter.sh 30059
-etc/gdm3/PreSession/Default 30058
-etc/gdm3/Xsession 30057
-etc/profile 30056
-etc/profile.d/bash_completion.sh 30055
-etc/profile.d/vte-2.91.sh 30054
-etc/profile.d/vte.sh 30053
-etc/X11/Xsession.d/20x11-common_process-args 30052
-etc/X11/Xsession.options 30051
-etc/X11/Xsession.d/30x11-common_xresources 30050
-usr/bin/xrdb 30049
-usr/lib/i386-linux-gnu/libXmuu.so.1.0.0 30048
-etc/X11/Xresources/x11-common 30047
-usr/bin/cpp-4.9 30046
-usr/lib/gcc/i586-linux-gnu/4.9/cc1 30045
-usr/lib/i386-linux-gnu/libcloog-isl.so.4.0.0 30044
-usr/lib/i386-linux-gnu/libisl.so.10.2.2 30043
-usr/lib/i386-linux-gnu/libmpc.so.3.0.0 30042
-usr/lib/i386-linux-gnu/libmpfr.so.4.1.2 30041
-etc/X11/Xsession.d/35x11-common_xhost-local 30040
-usr/bin/xhost 30039
-etc/X11/Xsession.d/40x11-common_xsessionrc 30038
-etc/amnesia/environment 30037
-etc/X11/Xsession.d/50x11-common_determine-startup 30036
-etc/X11/Xsession.d/55gnome-session_gnomerc 30035
-etc/X11/Xsession.d/56gnome-classic 30034
-usr/bin/whoami 30033
-etc/X11/Xsession.d/60xdg-user-dirs-update 30032
-usr/bin/xdg-user-dirs-update 30031
-etc/xdg/user-dirs.conf 30030
-etc/xdg/user-dirs.defaults 30029
-etc/X11/Xsession.d/70monkeysphere_use-validation-agent 30028
-etc/monkeysphere/monkeysphere.conf 30027
-etc/X11/Xsession.d/75dbus_dbus-launch 30026
-etc/X11/Xsession.d/90gpg-agent 30025
-usr/bin/gpg-agent 30024
-usr/lib/i386-linux-gnu/libassuan.so.0.4.2 30023
-usr/lib/i386-linux-gnu/libpth.so.20.0.27 30022
-etc/X11/Xsession.d/90qt-a11y 30021
-etc/X11/Xsession.d/90x11-common_ssh-agent 30020
-etc/X11/Xsession.d/98vboxadd-xclient 30019
-usr/bin/notify-send 30018
-etc/X11/Xsession.d/99x11-common_start 30017
-usr/bin/msva-perl 30016
-usr/share/perl5/Crypt/Monkeysphere/MSVA.pm 30015
-usr/share/perl5/HTTP/Server/Simple/CGI.pm 30014
-usr/share/perl5/HTTP/Server/Simple.pm 30013
-usr/lib/i386-linux-gnu/perl/5.20.2/Socket.pm 30012
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Socket/Socket.so 30011
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Select.pm 30010
-usr/share/perl5/HTTP/Server/Simple/CGI/Environment.pm 30009
-usr/share/perl5/Crypt/Monkeysphere/Validator.pm 30008
-usr/share/perl5/Crypt/Monkeysphere/Keyserver.pm 30007
-usr/share/perl5/GnuPG/Handles.pm 30006
-usr/share/perl5/Moo.pm 30005
-usr/share/perl5/strictures.pm 30004
-usr/share/perl5/Moo/_Utils.pm 30003
-usr/lib/i386-linux-gnu/perl5/5.20/Sub/Name.pm 30002
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Sub/Name/Name.so 30001
-usr/share/perl5/Module/Runtime.pm 30000
-usr/share/perl5/Devel/GlobalDestruction.pm 29999
-usr/share/perl5/Sub/Exporter/Progressive.pm 29998
-usr/share/perl5/Moo/_mro.pm 29997
-usr/lib/i386-linux-gnu/perl/5.20.2/mro.pm 29996
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/mro/mro.so 29995
-usr/share/perl5/Moo/HandleMoose/_TypeMap.pm 29994
-usr/share/perl5/Import/Into.pm 29993
-usr/share/perl5/Moo/sification.pm 29992
-usr/share/perl5/Moo/Object.pm 29991
-usr/share/perl5/MooX/late.pm 29990
-usr/share/perl5/Method/Generate/Constructor.pm 29989
-usr/share/perl5/Sub/Quote.pm 29988
-usr/share/perl5/Sub/Defer.pm 29987
-usr/lib/i386-linux-gnu/perl/5.20.2/B.pm 29986
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/B/B.so 29985
-usr/share/perl5/Method/Generate/Accessor.pm 29984
-usr/share/perl5/Moo/Role.pm 29983
-usr/share/perl5/Role/Tiny.pm 29982
-usr/share/perl5/GnuPG/HashInit.pm 29981
-usr/share/perl5/Type/Utils.pm 29980
-usr/share/perl5/Type/Library.pm 29979
-usr/share/perl5/Eval/TypeTiny.pm 29978
-usr/share/perl5/Exporter/Tiny.pm 29977
-usr/share/perl5/Type/Tiny.pm 29976
-usr/share/perl5/Types/TypeTiny.pm 29975
-usr/share/perl5/Type/Registry.pm 29974
-usr/share/perl5/Type/Parser.pm 29973
-usr/share/perl/5.20.2/Text/Balanced.pm 29972
-usr/share/perl/5.20.2/SelfLoader.pm 29971
-usr/share/perl5/Types/Standard.pm 29970
-usr/share/perl5/Type/Coercion.pm 29969
-usr/share/perl5/GnuPG/Interface.pm 29968
-usr/share/perl/5.20.2/English.pm 29967
-usr/lib/i386-linux-gnu/perl/5.20.2/Tie/Hash/NamedCapture.pm 29966
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Tie/Hash/NamedCapture/NamedCapture.so 29965
-usr/share/perl/5.20.2/Fatal.pm 29964
-usr/share/perl/5.20.2/Tie/RefHash.pm 29963
-usr/lib/i386-linux-gnu/perl/5.20.2/Config_heavy.pl 29962
-usr/lib/i386-linux-gnu/perl/5.20.2/Config_git.pl 29961
-usr/share/perl/5.20.2/Class/Struct.pm 29960
-usr/share/perl/5.20.2/Math/BigInt.pm 29959
-usr/share/perl/5.20.2/Math/BigInt/Calc.pm 29958
-usr/share/perl/5.20.2/integer.pm 29957
-usr/share/perl5/GnuPG/Options.pm 29956
-usr/share/perl5/MooX/HandlesVia.pm 29955
-usr/share/perl5/Data/Perl/Collection/Array/MooseLike.pm 29954
-usr/share/perl5/Role/Tiny/With.pm 29953
-usr/share/perl5/Class/Method/Modifiers.pm 29952
-usr/share/perl5/Data/Perl/Role/Collection/Array.pm 29951
-usr/lib/i386-linux-gnu/perl5/5.20/List/MoreUtils.pm 29950
-usr/lib/i386-linux-gnu/perl5/5.20/auto/List/MoreUtils/MoreUtils.so 29949
-usr/share/perl5/Type/Tiny/Class.pm 29948
-usr/share/perl5/File/HomeDir.pm 29947
-usr/share/perl5/File/Which.pm 29946
-usr/share/perl5/File/HomeDir/FreeDesktop.pm 29945
-usr/share/perl5/File/HomeDir/Unix.pm 29944
-usr/share/perl5/File/HomeDir/Driver.pm 29943
-usr/share/perl5/Config/General.pm 29942
-usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec/Functions.pm 29941
-usr/lib/i386-linux-gnu/perl/5.20.2/File/Glob.pm 29940
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/File/Glob/Glob.so 29939
-usr/share/perl5/Regexp/Common.pm 29938
-usr/share/perl5/Regexp/Common/net.pm 29937
-usr/share/perl5/Crypt/Monkeysphere/Logger.pm 29936
-usr/share/perl5/Crypt/Monkeysphere/Util.pm 29935
-usr/share/perl5/Crypt/X509.pm 29934
-usr/share/perl5/Convert/ASN1.pm 29933
-usr/share/perl5/Convert/ASN1/_decode.pm 29932
-usr/share/perl5/Convert/ASN1/_encode.pm 29931
-usr/share/perl5/Convert/ASN1/IO.pm 29930
-usr/share/perl5/Convert/ASN1/parser.pm 29929
-usr/lib/i386-linux-gnu/perl/5.20.2/MIME/Base64.pm 29928
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/MIME/Base64/Base64.so 29927
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket.pm 29926
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket/INET.pm 29925
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket/UNIX.pm 29924
-usr/share/perl5/Crypt/Monkeysphere/MSVA/MarginalUI.pm 29923
-usr/share/perl/5.20.2/Module/Load/Conditional.pm 29922
-usr/share/perl/5.20.2/Module/Load.pm 29921
-usr/share/perl/5.20.2/Params/Check.pm 29920
-usr/share/perl/5.20.2/Locale/Maketext/Simple.pm 29919
-usr/share/perl/5.20.2/version.pm 29918
-usr/share/perl/5.20.2/version/regex.pm 29917
-usr/share/perl/5.20.2/Module/Metadata.pm 29916
-usr/share/perl5/Crypt/Monkeysphere/MSVA/Monitor.pm 29915
-usr/share/perl5/Crypt/Monkeysphere/OpenPGP.pm 29914
-usr/lib/i386-linux-gnu/perl/5.20.2/Digest/SHA.pm 29913
-usr/share/perl/5.20.2/Digest/base.pm 29912
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Digest/SHA/SHA.so 29911
-usr/share/perl5/JSON.pm 29910
-usr/share/perl/5.20.2/JSON/PP.pm 29909
-usr/share/perl5/Method/Generate/BuildAll.pm 29908
-usr/share/perl5/Net/Server/MSVA.pm 29907
-usr/share/perl5/Net/Server/Fork.pm 29906
-usr/share/perl5/Net/Server.pm 29905
-usr/share/perl5/Net/Server/Proto.pm 29904
-usr/share/perl5/Net/Server/Daemonize.pm 29903
-usr/share/perl5/Net/Server/SIG.pm 29902
-usr/share/perl5/Net/Server/Proto/TCP.pm 29901
-usr/share/gnome-session/sessions/gnome-classic.session 29900
-usr/share/applications/gnome-shell-classic.desktop 29899
-usr/share/gnome/autostart/nautilus-autostart.desktop 29898
-etc/xdg/autostart/at-spi-dbus-bus.desktop 29897
-usr/share/applications/florence.desktop 29896
-usr/lib/gvfs/gvfsd 29895
-usr/lib/i386-linux-gnu/gvfs/libgvfsdaemon.so 29894
-usr/lib/i386-linux-gnu/libsecret-1.so.0.0.0 29893
-usr/share/gvfs/mounts/afc.mount 29892
-usr/share/gvfs/mounts/afp-browse.mount 29891
-usr/share/gvfs/mounts/afp.mount 29890
-usr/share/gvfs/mounts/archive.mount 29889
-usr/share/gvfs/mounts/burn.mount 29888
-usr/share/gvfs/mounts/cdda.mount 29887
-usr/share/gvfs/mounts/computer.mount 29886
-usr/share/gvfs/mounts/dav+sd.mount 29885
-usr/share/gvfs/mounts/dav.mount 29884
-usr/share/gvfs/mounts/dns-sd.mount 29883
-usr/share/gvfs/mounts/ftp.mount 29882
-usr/share/gvfs/mounts/gphoto2.mount 29881
-usr/share/gvfs/mounts/http.mount 29880
-usr/share/gvfs/mounts/localtest.mount 29879
-usr/share/gvfs/mounts/mtp.mount 29878
-usr/share/gvfs/mounts/network.mount 29877
-usr/share/gvfs/mounts/obexftp.mount 29876
-usr/share/gvfs/mounts/recent.mount 29875
-usr/share/gvfs/mounts/sftp.mount 29874
-usr/share/gvfs/mounts/smb-browse.mount 29873
-usr/share/gvfs/mounts/smb.mount 29872
-usr/share/gvfs/mounts/trash.mount 29871
-etc/xdg/autostart/gnome-keyring-gpg.desktop 29870
-etc/xdg/autostart/gnome-keyring-pkcs11.desktop 29869
-etc/xdg/autostart/gnome-keyring-secrets.desktop 29868
-etc/xdg/autostart/gnome-keyring-ssh.desktop 29867
-etc/xdg/autostart/gsettings-data-convert.desktop 29866
-etc/xdg/autostart/nm-applet.desktop 29865
-etc/xdg/autostart/notification-daemon.desktop 29864
-etc/xdg/autostart/openpgp-applet.desktop 29863
-etc/xdg/autostart/orca-autostart.desktop 29862
-etc/xdg/autostart/polkit-gnome-authentication-agent-1.desktop 29861
-etc/xdg/autostart/print-applet.desktop 29860
-etc/xdg/autostart/pulseaudio-kde.desktop 29859
-etc/xdg/autostart/pulseaudio.desktop 29858
-etc/xdg/autostart/systemd-desktop-target.desktop 29857
-usr/bin/gnome-keyring-daemon 29856
-usr/lib/i386-linux-gnu/libgcr-base-3.so.1.0.0 29855
-usr/bin/gsettings-data-convert 29854
-usr/lib/i386-linux-gnu/libgck-1.so.0.0.0 29853
-usr/share/GConf/gsettings/brasero.convert 29852
-usr/share/GConf/gsettings/eog.convert 29851
-usr/share/GConf/gsettings/evince.convert 29850
-usr/share/GConf/gsettings/evolution-data-server.convert 29849
-usr/share/GConf/gsettings/evolution.convert 29848
-usr/share/GConf/gsettings/file-roller.convert 29847
-usr/share/GConf/gsettings/gedit.convert 29846
-usr/share/GConf/gsettings/gnome-screenshot.convert 29845
-usr/share/GConf/gsettings/gnome-search-tool.convert 29844
-usr/share/GConf/gsettings/gnome-session.convert 29843
-usr/share/GConf/gsettings/gnome-settings-daemon.convert 29842
-usr/bin/start-pulseaudio-x11 29841
-usr/share/GConf/gsettings/gnome-shell-overrides.convert 29840
-usr/share/GConf/gsettings/gsettings-desktop-schemas.convert 29839
-usr/share/GConf/gsettings/gvfs-dns-sd.convert 29838
-usr/share/GConf/gsettings/gvfs-smb.convert 29837
-usr/share/GConf/gsettings/ibus.convert 29836
-usr/share/GConf/gsettings/libgnomekbd.convert 29835
-usr/share/GConf/gsettings/logview.convert 29834
-usr/share/GConf/gsettings/metacity-schemas.convert 29833
-usr/share/GConf/gsettings/mousetweaks.convert 29832
-usr/share/GConf/gsettings/mutter-schemas.convert 29831
-usr/share/GConf/gsettings/nautilus.convert 29830
-usr/share/GConf/gsettings/nm-applet.convert 29829
-usr/share/GConf/gsettings/opensubtitles.convert 29828
-usr/share/GConf/gsettings/org.gnome.crypto.cache.convert 29827
-usr/share/GConf/gsettings/org.gnome.crypto.pgp.convert 29826
-usr/share/GConf/gsettings/org.gnome.crypto.pgp_keyservers.convert 29825
-usr/share/GConf/gsettings/org.gnome.seahorse.convert 29824
-usr/share/GConf/gsettings/org.gnome.seahorse.manager.convert 29823
-usr/share/GConf/gsettings/org.gnome.seahorse.nautilus.convert 29822
-usr/share/GConf/gsettings/org.gnome.seahorse.recipients.convert 29821
-usr/share/GConf/gsettings/pythonconsole.convert 29820
-usr/share/GConf/gsettings/sound-juicer.convert 29819
-usr/share/GConf/gsettings/totem.convert 29818
-usr/share/GConf/gsettings/wm-schemas.convert 29817
-usr/lib/gnome-settings-daemon-3.0/libhousekeeping.so 29816
-usr/lib/gnome-settings-daemon-3.0/libgsdwacom.so 29815
-usr/lib/gnome-settings-daemon-3.0/libmouse.so 29810
-usr/lib/gnome-settings-daemon-3.0/libscreensaver-proxy.so 29809
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/drivers/net/virtio_net.ko 29808
-usr/lib/gnome-settings-daemon-3.0/libsharing.so 29804
-usr/lib/i386-linux-gnu/libnm-glib.so.4.8.0 29803
-usr/bin/pactl 29789
-usr/lib/i386-linux-gnu/libnm-util.so.2.6.0 29788
-usr/lib/gnome-settings-daemon-3.0/librfkill.so 29787
-usr/local/lib/tails-spoof-mac 29785
-usr/local/lib/tails-shell-library/hardware.sh 29784
-usr/local/lib/tails-shell-library/log.sh 29783
-usr/bin/gettext.sh 29782
-usr/bin/macchanger 29781
-usr/share/macchanger/OUI.list 29780
-usr/share/macchanger/wireless.list 29779
-lib/systemd/systemd-sysctl 29778
-etc/sysctl.d/dmesg_restrict.conf 29777
-etc/sysctl.d/kptr_restrict.conf 29776
-etc/sysctl.d/pmtud.conf 29775
-etc/sysctl.d/ptrace_scope.conf 29774
-etc/sysctl.d/tcp_timestamps.conf 29773
-usr/lib/gnome-settings-daemon-3.0/libprint-notifications.so 29771
-usr/lib/gnome-settings-daemon-3.0/libdatetime.so 29770
-usr/lib/libgeocode-glib.so.0.0.0 29769
-usr/lib/libgweather-3.so.6.3.2 29768
-usr/lib/i386-linux-gnu/libsoup-2.4.so.1.7.0 29767
-lib/systemd/system/NetworkManager.service 29766
-lib/systemd/system/NetworkManager-wait-online.service 29765
-lib/systemd/system/NetworkManager-dispatcher.service 29764
-run/systemd/#31002 29763
-usr/lib/gnome-settings-daemon-3.0/libcursor.so 29762
-lib/systemd/system-generators/systemd-sysv-generator 29761
-etc/init.d/apparmor 29760
-etc/init.d/gdomap 29759
-etc/init.d/hdparm 29758
-etc/init.d/rc 29757
-etc/init.d/rcS 29756
-etc/init.d/ttdnsd 29755
-lib/systemd/system-generators/systemd-system-update-generator 29754
-lib/systemd/system-generators/systemd-rc-local-generator 29753
-lib/systemd/system-generators/systemd-gpt-auto-generator 29752
-lib/systemd/system-generators/tor-generator 29751
-lib/systemd/system-generators/systemd-getty-generator 29750
-lib/systemd/system-generators/systemd-insserv-generator 29749
-lib/systemd/system-generators/systemd-fstab-generator 29748
-etc/insserv.conf.d/gdm3 29747
-etc/insserv.conf 29746
-lib/systemd/system-generators/systemd-debug-generator 29745
-lib/systemd/system-generators/systemd-default-display-manager-generator 29744
-lib/systemd/system-generators/systemd-cryptsetup-generator 29743
-etc/crypttab 29742
-lib/systemd/system/sys-fs-fuse-connections.mount 29741
-lib/systemd/system/system.slice 29740
-lib/systemd/system/-.slice 29739
-lib/systemd/system/slices.target 29738
-lib/systemd/system/systemd-journald.socket 29737
-lib/systemd/system/systemd-journald.service 29736
-lib/systemd/system/syslog.socket 29735
-lib/systemd/system/systemd-setup-dgram-qlen.service 29734
-lib/systemd/system/systemd-journald-dev-log.socket 29733
-lib/systemd/system/systemd-udevd-kernel.socket 29732
-lib/systemd/system/systemd-udevd.service 29731
-lib/systemd/system/systemd-udevd-control.socket 29730
-lib/systemd/system/systemd-shutdownd.socket 29729
-lib/systemd/system/systemd-shutdownd.service 29728
-lib/systemd/system/systemd-initctl.socket 29727
-lib/systemd/system/systemd-initctl.service 29726
-lib/systemd/system/dbus.socket 29725
-lib/systemd/system/dbus.service 29724
-lib/systemd/system/basic.target 29723
-lib/systemd/system/live-config.service 29722
-lib/systemd/system/systemd-tmpfiles-clean.timer 29721
-lib/systemd/system/systemd-tmpfiles-clean.service 29720
-lib/systemd/system/time-sync.target 29719
-lib/systemd/system/local-fs.target 29718
-lib/systemd/system/systemd-remount-fs.service 29717
-lib/systemd/system/systemd-fsck-root.service 29716
-lib/systemd/system/umount.target 29715
-lib/systemd/system/lvm2-activation.service 29714
-lib/systemd/system/systemd-udev-settle.service 29713
-lib/systemd/system/systemd-udev-trigger.service 29712
-lib/systemd/system/cryptsetup.target 29711
-lib/systemd/system/lvm2-activation-early.service 29710
-lib/systemd/system/emergency.target 29709
-lib/systemd/system/emergency.service 29708
-lib/systemd/system/rescue.service 29707
-lib/systemd/system/plymouth-start.service 29706
-lib/systemd/system/systemd-ask-password-plymouth.service 29705
-lib/systemd/system/systemd-ask-password-plymouth.path 29704
-lib/systemd/system/local-fs-pre.target 29703
-lib/systemd/system/systemd-readahead-replay.service 29702
-lib/systemd/system/systemd-readahead-collect.service 29701
-lib/systemd/system/systemd-readahead-done.timer 29700
-lib/systemd/system/systemd-readahead-done.service 29699
-lib/systemd/system/graphical.target 29698
-lib/systemd/system/systemd-update-utmp-runlevel.service 29697
-lib/systemd/system/remote-fs.target 29696
-lib/systemd/system/remote-fs-pre.target 29695
-lib/systemd/system/multi-user.target 29694
-lib/systemd/system/systemd-user-sessions.service 29693
-lib/systemd/system/network.target 29692
-lib/systemd/system/network-pre.target 29691
-lib/systemd/system/nss-user-lookup.target 29690
-lib/systemd/system/systemd-logind.service 29689
-lib/systemd/system/user.slice 29688
-lib/systemd/system/systemd-ask-password-wall.path 29687
-lib/systemd/system/systemd-ask-password-wall.service 29686
-lib/systemd/system/plymouth-quit.service 29685
-lib/systemd/system/plymouth-quit-wait.service 29684
-lib/systemd/system/getty.target 29683
-lib/systemd/system/getty-static.service 29682
-lib/systemd/system/getty@.service 29681
-lib/systemd/system/rc-local.service 29680
-lib/systemd/system/tor-controlport-filter.service 29679
-lib/systemd/system/tails-set-wireless-devices-state.service 29678
-lib/systemd/system/tails-sdmem-on-media-removal.service 29677
-lib/systemd/system/tails-reconfigure-memlockd.service 29676
-lib/systemd/system/tails-reconfigure-kexec.service 29675
-lib/systemd/system/tails-autotest-remote-shell.service 29674
-lib/systemd/system/gdm.service 29673
-lib/systemd/system/gdm.service.d/restart.conf 29672
-lib/systemd/system/pppd-dns.service 29671
-lib/systemd/system/open-vm-tools.service 29670
-lib/systemd/system/memlockd.service 29669
-lib/systemd/system/memlockd.service.d/oom.conf 29668
-lib/systemd/system/cron.service 29667
-lib/systemd/system/ModemManager.service 29666
-lib/systemd/system/rescue.target 29665
-lib/systemd/system/systemd-update-utmp.service 29664
-lib/systemd/system/systemd-tmpfiles-setup.service 29663
-lib/systemd/system/tails-tor-has-bootstrapped.target 29662
-lib/systemd/system/tails-wait-until-tor-has-bootstrapped.service 29661
-lib/systemd/system/tor@default.service 29660
-lib/systemd/system/tor@default.service.d/fix-obfs4proxy.conf 29659
-lib/systemd/system/tor@default.service.d/writable-etc-tor.conf 29658
-lib/systemd/system/tor.service 29657
-lib/systemd/system/nss-lookup.target 29656
-lib/systemd/system/tails-tor-has-bootstrapped-flag-file.service 29655
-lib/systemd/system/accounts-daemon.service 29654
-lib/systemd/system/haveged.service 29653
-lib/systemd/system/pcscd.socket 29652
-lib/systemd/system/pcscd.service 29651
-lib/systemd/system/dm-event.socket 29650
-lib/systemd/system/dm-event.service 29649
-lib/systemd/system/cups.socket 29648
-lib/systemd/system/cups.service 29647
-lib/systemd/system/cups.service.d/after-AppArmor.conf 29646
-lib/systemd/system/sysinit.target 29645
-lib/systemd/system/network-online.target 29644
-lib/systemd/system/networking.service.d/network-pre.conf 29643
-lib/systemd/system/systemd-random-seed.service 29642
-lib/systemd/system/udev-finish.service 29641
-lib/systemd/system/systemd-tmpfiles-setup-dev.service 29640
-lib/systemd/system/systemd-sysctl.service 29639
-lib/systemd/system/systemd-journal-flush.service 29638
-lib/systemd/system/systemd-binfmt.service 29637
-lib/systemd/system/systemd-ask-password-console.path 29636
-lib/systemd/system/systemd-ask-password-console.service 29635
-lib/systemd/system/sys-kernel-debug.mount 29634
-lib/systemd/system/sys-kernel-config.mount 29633
-lib/systemd/system/proc-sys-fs-binfmt_misc.automount 29632
-lib/systemd/system/proc-sys-fs-binfmt_misc.mount 29631
-lib/systemd/system/plymouth-read-write.service 29630
-lib/systemd/system/kmod-static-nodes.service 29629
-lib/systemd/system/dev-mqueue.mount 29628
-lib/systemd/system/dev-hugepages.mount 29627
-lib/systemd/system/debian-fixup.service 29626
-lib/systemd/system/lvm2-monitor.service 29625
-lib/systemd/system/lvm2-lvmetad.service 29624
-lib/systemd/system/lvm2-lvmetad.socket 29623
-lib/systemd/system/swap.target 29622
-lib/systemd/system/systemd-modules-load.service 29621
-usr/sbin/NetworkManager 29620
-usr/lib/NetworkManager/nm-dispatcher 29619
-usr/lib/i386-linux-gnu/libnl-route-3.so.200.19.0 29618
-lib/i386-linux-gnu/libnl-genl-3.so.200.19.0 29617
-lib/i386-linux-gnu/libnl-3.so.200.19.0 29616
-usr/lib/i386-linux-gnu/libteamdctl.so.0.1.1 29615
-usr/lib/i386-linux-gnu/libndp.so.0.0.2 29614
-etc/libnl-3/classid 29613
-usr/lib/gnome-settings-daemon-3.0/libupdates.so 29612
-etc/NetworkManager/NetworkManager.conf 29611
-usr/lib/i386-linux-gnu/libpackagekit-glib2.so.18.0.1 29610
-etc/NetworkManager/conf.d/dhcp-hostname.conf 29609
-etc/NetworkManager/conf.d/dns.conf 29608
-etc/NetworkManager/conf.d/plugins.conf 29607
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/rfkill/rfkill.ko 29606
-usr/lib/i386-linux-gnu/gio/modules/libgioremote-volume-monitor.so 29605
-usr/share/gvfs/remote-volume-monitors/afc.monitor 29604
-usr/share/gvfs/remote-volume-monitors/goa.monitor 29603
-usr/share/gvfs/remote-volume-monitors/gphoto2.monitor 29602
-usr/share/gvfs/remote-volume-monitors/mtp.monitor 29601
-usr/share/gvfs/remote-volume-monitors/udisks2.monitor 29600
-usr/lib/gvfs/gvfs-udisks2-volume-monitor 29599
-usr/lib/i386-linux-gnu/libudisks2.so.0.0.0 29597
-lib/modules/4.7.0-0.bpo.1-amd64/kernel/net/wireless/cfg80211.ko 29596
-lib/systemd/system/udisks2.service 29595
-usr/lib/udisks2/udisksd 29594
-lib/i386-linux-gnu/libatasmart.so.4.0.5 29593
-sbin/crda 29590
-lib/crda/libreg.so 29589
-lib/crda/regulatory.bin 29588
-lib/crda/pubkeys/benh@debian.org.key.pub.pem 29587
-usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-adsl.so 29586
-usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-bluetooth.so 29585
-usr/lib/i386-linux-gnu/NetworkManager/libnm-wwan.so 29584
-usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-wifi.so 29583
-usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-wwan.so 29582
-usr/lib/gvfs/gvfs-mtp-volume-monitor 29581
-usr/bin/nm-online 29580
-etc/dhcp/dhclient.conf 29579
-sbin/dhclient 29578
-lib/i386-linux-gnu/libirs-export.so.91.0.0 29577
-lib/i386-linux-gnu/libdns-export.so.100.2.2 29576
-lib/i386-linux-gnu/libisc-export.so.95.5.0 29575
-lib/i386-linux-gnu/libisccfg-export.so.90.1.0 29574
-usr/lib/gvfs/gvfs-gphoto2-volume-monitor 29573
-usr/lib/NetworkManager/nm-dhcp-helper 29572
-usr/lib/i386-linux-gnu/libgphoto2.so.6.0.0 29571
-usr/lib/i386-linux-gnu/libgphoto2_port.so.10.1.1 29570
-usr/lib/i386-linux-gnu/libexif.so.12.3.3 29569
-usr/lib/gvfs/gvfs-goa-volume-monitor 29568
-usr/lib/i386-linux-gnu/libgoa-1.0.so.0.0.0 29567
-usr/lib/gvfs/gvfs-afc-volume-monitor 29565
-usr/bin/gnome-shell 29564
-usr/lib/gnome-shell/libgnome-shell.so 29563
-lib/systemd/system/systemd-hostnamed.service 29562
-usr/lib/gnome-shell/libgnome-shell-js.so 29561
-usr/lib/libgjs.so.0.0.0 29560
-usr/share/libwacom/serial-wacf004.tablet 29559
-usr/share/libwacom/n-trig-pen.tablet 29558
-usr/share/libwacom/isdv4-ef.tablet 29557
-usr/share/libwacom/isdv4-ed.tablet 29556
-usr/share/libwacom/isdv4-ec.tablet 29555
-usr/share/libwacom/isdv4-e6.tablet 29554
-usr/share/libwacom/isdv4-e5.tablet 29553
-usr/share/libwacom/isdv4-e3.tablet 29552
-usr/share/libwacom/isdv4-93.tablet 29551
-usr/share/libwacom/isdv4-90.tablet 29550
-usr/share/libwacom/isdv4-10f.tablet 29549
-usr/share/libwacom/isdv4-10d.tablet 29548
-usr/share/libwacom/isdv4-101.tablet 29547
-usr/share/libwacom/isdv4-100.tablet 29546
-usr/share/libwacom/intuos-pro-s.tablet 29545
-usr/share/libwacom/intuos-pro-m.tablet 29544
-usr/share/libwacom/intuos-pro-l.tablet 29543
-usr/share/libwacom/intuos-9x12.tablet 29542
-usr/share/libwacom/intuos-6x8.tablet 29541
-usr/share/libwacom/intuos5-touch-s.tablet 29540
-usr/share/libwacom/intuos5-touch-m.tablet 29539
-usr/share/libwacom/intuos5-touch-l.tablet 29538
-usr/share/libwacom/intuos5-s.tablet 29537
-usr/share/libwacom/intuos5-m.tablet 29536
-usr/share/libwacom/intuos-4x5.tablet 29535
-usr/share/libwacom/intuos4-8x13.tablet 29534
-usr/share/libwacom/intuos4-6x9-wl.tablet 29533
-usr/share/libwacom/intuos4-6x9.tablet 29532
-usr/share/libwacom/intuos4-4x6.tablet 29531
-usr/share/libwacom/intuos4-12x19.tablet 29530
-usr/share/libwacom/intuos3-9x12.tablet 29529
-usr/share/libwacom/intuos3-6x8.tablet 29528
-usr/share/libwacom/intuos3-6x11.tablet 29527
-usr/share/libwacom/intuos3-4x6.tablet 29526
-usr/share/libwacom/intuos3-4x5.tablet 29525
-usr/share/libwacom/intuos3-12x19.tablet 29524
-usr/share/libwacom/intuos3-12x12.tablet 29523
-usr/share/libwacom/intuos2-9x12.tablet 29522
-usr/share/libwacom/intuos2-6x8.tablet 29521
-usr/share/libwacom/intuos2-4x5.tablet 29520
-usr/share/libwacom/intuos2-12x18.tablet 29519
-usr/share/libwacom/intuos2-12x12.tablet 29518
-usr/share/libwacom/intuos-12x18.tablet 29517
-usr/share/libwacom/intuos-12x12.tablet 29516
-usr/share/libwacom/graphire-wireless-8x6.tablet 29515
-usr/share/libwacom/graphire4-4x5.tablet 29514
-usr/share/libwacom/graphire3-6x8.tablet 29513
-usr/share/libwacom/graphire3-4x5.tablet 29512
-usr/share/libwacom/generic.tablet 29511
-usr/share/libwacom/dtu-2231.tablet 29510
-usr/share/libwacom/dtu-1931.tablet 29509
-usr/share/libwacom/dtu-1631.tablet 29508
-usr/share/libwacom/dtk-2241.tablet 29507
-usr/share/libwacom/dti-520.tablet 29506
-usr/share/libwacom/dth-2242.tablet 29505
-usr/share/libwacom/dtf-720.tablet 29504
-usr/share/libwacom/cintiq-24hd-touch.tablet 29503
-usr/share/libwacom/cintiq-24hd.tablet 29502
-usr/share/libwacom/cintiq-22hdt.tablet 29501
-usr/share/libwacom/cintiq-22hd.tablet 29500
-usr/share/libwacom/cintiq-21ux.tablet 29499
-usr/share/libwacom/cintiq-21ux2.tablet 29498
-usr/share/libwacom/cintiq-20wsx.tablet 29497
-usr/share/libwacom/cintiq-13hd.tablet 29496
-usr/share/libwacom/cintiq-12wx.tablet 29495
-usr/share/libwacom/bamboo-pen.tablet 29494
-usr/share/libwacom/bamboo-one.tablet 29493
-usr/share/libwacom/bamboo-craft.tablet 29492
-usr/share/libwacom/bamboo-2fg.tablet 29491
-usr/share/libwacom/bamboo-2fg-6x8.tablet 29490
-usr/share/libwacom/bamboo-2fg-4x5.tablet 29489
-usr/share/libwacom/libwacom.stylus 29488
-usr/sbin/cupsd 29487
-usr/lib/i386-linux-gnu/libcupsmime.so.1 29486
-usr/lib/i386-linux-gnu/libpaper.so.1.1.2 29485
-lib/systemd/systemd-hostnamed 29484
-etc/cups/cups-files.conf 29483
-etc/cups/cupsd.conf 29482
-etc/os-release 29481
-etc/papersize 29480
-usr/share/cups/mime/command.types 29479
-usr/share/cups/mime/cupsfilters.types 29478
-usr/share/cups/mime/mime.types 29477
-usr/share/cups/mime/pstotiff.types 29476
-etc/cups/raw.types 29475
-usr/share/cups/mime/cupsfilters.convs 29474
-usr/share/cups/mime/mime.convs 29473
-usr/share/cups/mime/pstotiff.convs 29472
-etc/cups/raw.convs 29471
-usr/share/cups/banners/classified 29470
-usr/share/cups/banners/confidential 29469
-usr/share/cups/banners/form 29468
-usr/share/cups/banners/secret 29467
-usr/share/cups/banners/standard 29466
-usr/share/cups/banners/topsecret 29465
-usr/share/cups/banners/unclassified 29464
-usr/lib/gnome-settings-daemon/gsd-printer 29463
-usr/lib/i386-linux-gnu/libtelepathy-glib.so.0.84.1 29462
-usr/lib/libmutter.so.0.0.0 29461
-usr/lib/i386-linux-gnu/libclutter-1.0.so.0.2000.0 29460
-usr/lib/i386-linux-gnu/libcogl-pango.so.20.2.0 29459
-usr/lib/gnome-shell/libgnome-shell-menu.so 29458
-usr/lib/i386-linux-gnu/libgstbase-1.0.so.0.404.0 29457
-usr/lib/i386-linux-gnu/libgstreamer-1.0.so.0.404.0 29456
-usr/lib/i386-linux-gnu/libpolkit-agent-1.so.0.0.0 29455
-usr/lib/i386-linux-gnu/libcogl.so.20.2.0 29454
-usr/lib/i386-linux-gnu/libmozjs-24.so.0.0.0 29453
-usr/lib/i386-linux-gnu/libxkbcommon-x11.so.0.0.0 29452
-usr/lib/i386-linux-gnu/libxcb-randr.so.0.1.0 29451
-usr/lib/i386-linux-gnu/libwayland-server.so.0.1.0 29450
-usr/lib/i386-linux-gnu/libinput.so.5.0.0 29449
-usr/lib/i386-linux-gnu/libgbm.so.1.0.0 29448
-usr/lib/i386-linux-gnu/libcogl-path.so.20.2.0 29447
-usr/lib/i386-linux-gnu/libwayland-egl.so.1.0.0 29446
-usr/lib/i386-linux-gnu/libEGL.so.1.0.0 29445
-usr/lib/i386-linux-gnu/libxcb-xkb.so.1.0.0 29444
-usr/lib/i386-linux-gnu/libxcb-xfixes.so.0.0.0 29443
-usr/lib/i386-linux-gnu/libxcb-shape.so.0.0.0 29442
-usr/lib/i386-linux-gnu/libcanberra-0.30/libcanberra-alsa.so 29441
-usr/lib/girepository-1.0/Clutter-1.0.typelib 29440
-usr/lib/girepository-1.0/Json-1.0.typelib 29439
-usr/lib/i386-linux-gnu/girepository-1.0/GL-1.0.typelib 29438
-usr/lib/girepository-1.0/CoglPango-1.0.typelib 29437
-usr/lib/i386-linux-gnu/girepository-1.0/PangoCairo-1.0.typelib 29436
-usr/lib/i386-linux-gnu/girepository-1.0/PangoFT2-1.0.typelib 29435
-usr/lib/i386-linux-gnu/girepository-1.0/freetype2-2.0.typelib 29434
-usr/lib/i386-linux-gnu/girepository-1.0/fontconfig-2.0.typelib 29433
-usr/lib/girepository-1.0/Cogl-1.0.typelib 29432
-usr/lib/gjs/girepository-1.0/GjsPrivate-1.0.typelib 29431
-usr/lib/gnome-shell/Shell-0.1.typelib 29430
-usr/lib/girepository-1.0/TelepathyGLib-0.12.typelib 29429
-usr/lib/gnome-shell/St-1.0.typelib 29428
-usr/lib/gnome-shell/ShellMenu-0.1.typelib 29427
-usr/lib/i386-linux-gnu/girepository-1.0/NetworkManager-1.0.typelib 29426
-usr/lib/i386-linux-gnu/girepository-1.0/DBusGLib-1.0.typelib 29425
-usr/lib/i386-linux-gnu/girepository-1.0/NMClient-1.0.typelib 29424
-usr/lib/mutter/Meta-3.0.typelib 29423
-usr/lib/i386-linux-gnu/girepository-1.0/xfixes-4.0.typelib 29422
-usr/lib/girepository-1.0/GDesktopEnums-3.0.typelib 29421
-usr/lib/girepository-1.0/ClutterX11-1.0.typelib 29420
-etc/NetworkManager/dispatcher.d/00-firewall.sh 29419
-usr/lib/i386-linux-gnu/girepository-1.0/Polkit-1.0.typelib 29418
-usr/lib/girepository-1.0/GnomeDesktop-3.0.typelib 29417
-usr/lib/gnome-shell/ShellJS-0.1.typelib 29416
-usr/lib/girepository-1.0/Caribou-1.0.typelib 29415
-lib/xtables/libxt_conntrack.so 29414
-usr/lib/i386-linux-gnu/girepository-1.0/IBus-1.0.typelib 29413
-usr/lib/girepository-1.0/Atspi-2.0.typelib 29412
-usr/share/gnome-shell/modes/classic.json 29411
-etc/gnome/defaults.list 29410
-usr/share/applications/mimeinfo.cache 29409
-usr/share/gnome/applications/vim.desktop 29408
-usr/share/gnome/applications/nm-connection-editor.desktop 29407
-usr/share/gnome/applications/gnome-power-statistics.desktop 29406
-usr/share/gnome/applications/openjdk-7-policytool.desktop 29405
-usr/share/gnome/applications/orca.desktop 29404
-usr/share/applications/gnome-bluetooth-panel.desktop 29403
-usr/lib/libreoffice/share/xdg/xsltfilter.desktop 29402
-usr/share/applications/traverso.desktop 29401
-usr/share/applications/liferea.desktop 29400
-usr/lib/libreoffice/share/xdg/math.desktop 29399
-usr/share/applications/sound-juicer.desktop 29398
-usr/share/applications/python3.4.desktop 29397
-usr/share/applications/pidgin.desktop 29396
-usr/share/applications/gnome-system-log.desktop 29395
-usr/share/applications/synaptic-kde.desktop 29394
-usr/share/applications/evince-previewer.desktop 29393
-usr/share/applications/ibus-setup-pinyin.desktop 29392
-usr/share/applications/tails-installer-launcher.desktop 29391
-usr/share/applications/gnome-sound-panel.desktop 29390
-usr/share/applications/poedit.desktop 29389
-usr/share/applications/tails-persistence-delete.desktop 29388
-usr/share/applications/simple-scan.desktop 29387
-usr/share/applications/gnome-disk-image-mounter.desktop 29386
-usr/share/applications/gnome-shell-wayland.desktop 29385
-usr/share/applications/seahorse.desktop 29384
-etc/NetworkManager/dispatcher.d/00-save-env 29383
-usr/share/applications/ibus-setup-anthy.desktop 29382
-usr/share/applications/gcr-prompter.desktop 29381
-usr/share/applications/gnome-search-tool.desktop 29380
-usr/share/applications/gcr-viewer.desktop 29379
-usr/share/applications/gnome-wacom-panel.desktop 29378
-usr/share/applications/gnome-terminal.desktop 29377
-usr/share/applications/yelp.desktop 29376
-usr/share/applications/pitivi.desktop 29375
-usr/share/applications/python2.7.desktop 29374
-usr/share/applications/gobby-0.5.desktop 29373
-usr/lib/libreoffice/share/xdg/startcenter.desktop 29372
-usr/share/applications/tails-documentation.desktop 29371
-usr/share/applications/gnome-control-center.desktop 29370
-usr/share/applications/unsafe-browser.desktop 29369
-usr/share/applications/gnome-search-panel.desktop 29368
-usr/share/applications/org.gnome.FileRoller.desktop 29367
-usr/share/applications/tails-about.desktop 29366
-usr/share/applications/tor-browser.desktop 29365
-usr/share/applications/brasero.desktop 29364
-usr/share/applications/gnome-panel.desktop 29363
-usr/share/applications/gstreamer-properties.desktop 29362
-usr/share/applications/org.gnome.Shell.PortalHelper.desktop 29361
-usr/share/applications/gnome-power-panel.desktop 29360
-usr/share/applications/audacity.desktop 29359
-usr/share/applications/org.gnome.gedit.desktop 29358
-usr/share/applications/tails-persistence-setup.desktop 29357
-usr/share/applications/gnome-info-panel.desktop 29356
-usr/share/applications/gnome-wm.desktop 29355
-usr/share/applications/nm-applet.desktop 29354
-etc/NetworkManager/dispatcher.d/01-wait-for-notification-recipient.sh 29353
-usr/share/applications/gnome-shell.desktop 29352
-usr/share/applications/ibus-setup-bopomofo.desktop 29351
-usr/share/applications/gnome-region-panel.desktop 29350
-usr/share/applications/gnome-calculator.desktop 29349
-usr/share/applications/evince.desktop 29348
-usr/share/applications/gnome-keyboard-panel.desktop 29347
-usr/share/applications/gnome-notifications-panel.desktop 29346
-usr/share/applications/gkbd-keyboard-display.desktop 29345
-usr/share/applications/gnome-disks.desktop 29344
-usr/lib/libreoffice/share/xdg/calc.desktop 29343
-usr/share/applications/brasero-nautilus.desktop 29342
-usr/share/applications/gnome-shell-extension-prefs.desktop 29341
-usr/share/applications/bookletimposer.desktop 29340
-usr/share/applications/eog.desktop 29339
-usr/share/applications/ibus-setup-hangul.desktop 29338
-usr/share/applications/gnome-datetime-panel.desktop 29337
-usr/share/applications/ibus-setup.desktop 29336
-usr/share/applications/gnome-universal-access-panel.desktop 29335
-usr/share/applications/electrum.desktop 29334
-usr/share/applications/nautilus-classic.desktop 29333
-usr/share/applications/gnome-color-panel.desktop 29332
-usr/share/applications/dasher.desktop 29331
-usr/share/applications/gnome-mouse-panel.desktop 29330
-usr/share/applications/gnome-system-monitor.desktop 29329
-usr/share/applications/gtkhash.desktop 29328
-usr/lib/libreoffice/share/xdg/writer.desktop 29327
-usr/share/applications/gnome-disk-image-writer.desktop 29326
-usr/share/applications/gnome-printers-panel.desktop 29325
-usr/share/applications/org.gnome.Totem.desktop 29324
-usr/share/applications/keepassx.desktop 29323
-usr/share/applications/icedove.desktop 29322
-usr/share/applications/mutter-wayland.desktop 29321
-usr/lib/libreoffice/share/xdg/impress.desktop 29320
-usr/share/applications/gimp.desktop 29319
-usr/share/applications/seahorse-pgp-encrypted.desktop 29318
-usr/share/applications/notification-daemon.desktop 29317
-usr/share/applications/gnome-display-panel.desktop 29316
-usr/share/applications/org.gnome.Screenshot.desktop 29315
-usr/share/applications/onioncircuits.desktop 29314
-usr/share/applications/gnome-sharing-panel.desktop 29313
-usr/share/applications/gnome-screensaver.desktop 29312
-usr/share/applications/evolution-calendar.desktop 29311
-usr/lib/libreoffice/share/xdg/draw.desktop 29310
-usr/share/applications/gnome-network-panel.desktop 29309
-usr/share/applications/nautilus-connect-server.desktop 29308
-usr/share/applications/gnome-privacy-panel.desktop 29307
-usr/share/applications/gnome-background-panel.desktop 29306
-usr/share/applications/seahorse-pgp-keys.desktop 29305
-usr/share/applications/inkscape.desktop 29304
-usr/share/applications/mat.desktop 29303
-usr/share/applications/gnome-user-accounts-panel.desktop 29302
-usr/share/applications/gnome-system-monitor-kde.desktop 29301
-usr/share/applications/nautilus-autorun-software.desktop 29300
-usr/share/applications/scribus.desktop 29299
-usr/share/applications/seahorse-pgp-signature.desktop 29298
-usr/share/applications/mutter.desktop 29297
-usr/share/applications/whisperback.desktop 29296
-usr/share/applications/org.gnome.Nautilus.desktop 29295
-usr/share/gnome-shell/theme/gnome-classic.css 29294
-usr/share/gnome-shell/theme/gnome-shell.css 29293
-usr/share/tails/screensaver_background.png 29292
-usr/share/xml/iso-codes/iso_639_3.xml 29291
-usr/bin/ibus-daemon 29290
-usr/share/ibus/keymaps/us 29289
-usr/share/ibus/keymaps/common 29288
-usr/share/ibus/keymaps/modifiers 29287
-usr/share/ibus/component/anthy.xml 29286
-usr/lib/ibus/ibus-engine-anthy 29285
-usr/bin/python3.4 29284
-usr/share/locale/en/LC_MESSAGES/gnome-desktop-3.0.mo 29283
-bin/false 29280
-usr/lib/girepository-1.0/NMGtk-1.0.typelib 29267
-usr/lib/girepository-1.0/GnomeBluetooth-1.0.typelib 29263
-usr/lib/libgnome-bluetooth.so.13.0.0 29260
-usr/lib/girepository-1.0/UPowerGlib-1.0.typelib 29258
-usr/share/ibus-anthy/engine/main.py 29257
-usr/lib/python3.4/getopt.py 29256
-usr/lib/python3.4/gettext.py 29255
-usr/lib/gnome-shell/Gvc-1.0.typelib 29254
-usr/lib/python3.4/xml/__init__.py 29237
-usr/lib/python3.4/xml/dom/__init__.py 29236
-usr/lib/python3.4/xml/dom/domreg.py 29235
-usr/lib/python3.4/xml/dom/minidom.py 29234
-usr/share/xsessions/gnome-classic.desktop 29233
-usr/share/xsessions/gnome-fallback.desktop 29232
-usr/share/xsessions/gnome.desktop 29231
-usr/lib/python3.4/xml/dom/minicompat.py 29230
-usr/share/wayland-sessions/gnome-wayland.desktop 29229
-usr/lib/python3.4/xml/dom/xmlbuilder.py 29228
-usr/lib/python3.4/xml/dom/NodeFilter.py 29227
-usr/lib/python3/dist-packages/gi/__init__.py 29226
-usr/lib/i386-linux-gnu/girepository-1.0/PolkitAgent-1.0.typelib 29225
-usr/lib/python3.4/__future__.py 29224
-usr/lib/python3.4/pkgutil.py 29223
-usr/lib/girepository-1.0/TelepathyLogger-0.2.typelib 29222
-usr/lib/girepository-1.0/Gcr-3.typelib 29221
-usr/lib/girepository-1.0/Gck-1.typelib 29220
-usr/share/gnome-shell/theme/noise-texture.png 29219
-usr/share/gnome-shell/search-providers/gnome-calculator-search-provider.ini 29218
-usr/share/gnome-shell/search-providers/gnome-control-center-search-provider.ini 29217
-usr/share/gnome-shell/search-providers/gnome-terminal-search-provider.ini 29216
-usr/share/gnome-shell/search-providers/nautilus-search-provider.ini 29215
-usr/share/gnome-shell/search-providers/seahorse-search-provider.ini 29214
-usr/local/lib/start-systemd-desktop-target 29213
-usr/lib/i386-linux-gnu/gio/modules/libgiognutls.so 29212
-etc/ssl/certs/ca-certificates.crt 29211
-usr/bin/xargs 29209
-usr/bin/nautilus 29208
-usr/lib/systemd/user/desktop.target 29207
-usr/lib/systemd/user/tails-wait-until-tor-has-bootstrapped.service 29206
-usr/lib/systemd/user/tails-virt-notify-user.service 29205
-usr/lib/systemd/user/tails-upgrade-frontend.service 29204
-usr/lib/systemd/user/tails-security-check.service 29203
-usr/lib/systemd/user/tails-configure-keyboard.service 29202
-usr/lib/python3.4/importlib/__init__.py 29201
-usr/lib/python3.4/importlib/util.py 29199
-usr/lib/python3.4/importlib/machinery.py 29197
-usr/lib/i386-linux-gnu/gio/modules/libgiolibproxy.so 29196
-usr/lib/i386-linux-gnu/libproxy.so.1.0.0 29195
-usr/lib/i386-linux-gnu/gio/modules/libgiognomeproxy.so 29194
-usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/metadata.json 29193
-usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/extension.js 29192
-usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/stylesheet.css 29191
-usr/local/lib/tails-virt-notify-user 29190
-usr/share/perl5/Desktop/Notify.pm 29189
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus.pm 29188
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Net/DBus/DBus.so 29187
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Bus.pm 29186
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Connection.pm 29185
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/MethodCall.pm 29184
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message.pm 29183
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Iterator.pm 29182
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/Signal.pm 29181
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/MethodReturn.pm 29180
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/Error.pm 29179
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/PendingCall.pm 29178
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Service.pm 29177
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/RemoteService.pm 29176
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/RemoteObject.pm 29175
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Introspector.pm 29174
-usr/share/perl5/XML/Twig.pm 29173
-usr/share/perl/5.20.2/UNIVERSAL.pm 29172
-usr/local/lib/tails-configure-keyboard 29171
-usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 29170
-usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/extension.js 29169
-usr/lib/i386-linux-gnu/girepository-1.0/GMenu-3.0.typelib 29168
-usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/convenience.js 29167
-etc/NetworkManager/dispatcher.d/01ifupdown 29166
-usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/stylesheet.css 29165
-usr/lib/libgnome-menu-3.so.0.0.1 29164
-lib/init/vars.sh 29163
-etc/default/rcS 29162
-usr/lib/i386-linux-gnu/perl5/5.20/XML/Parser.pm 29161
-lib/init/mount-functions.sh 29160
-usr/bin/florence 29159
-usr/lib/i386-linux-gnu/libtracker-sparql-1.0.so.0.202.2 29158
-usr/lib/i386-linux-gnu/perl5/5.20/XML/Parser/Expat.pm 29157
-usr/lib/libnautilus-extension.so.1.4.0 29156
-usr/lib/i386-linux-gnu/libgailutil-3.so.0.0.0 29155
-usr/lib/i386-linux-gnu/libexempi.so.3.2.3 29154
-usr/lib/python3/dist-packages/gi/_gi.cpython-34m-i386-linux-gnu.so 29153
-etc/NetworkManager/dispatcher.d/10-tor.sh 29152
-etc/xdg/menus/gnome-applications.menu 29151
-usr/lib/i386-linux-gnu/libflorence-1.0.so.1.0.0 29150
-usr/bin/nm-applet 29149
-usr/lib/i386-linux-gnu/libnm-gtk.so.0.0.0 29148
-usr/lib/i386-linux-gnu/libnm-glib-vpn.so.1.2.0 29147
-usr/lib/notification-daemon/notification-daemon 29146
-usr/bin/torsocks 29145
-usr/lib/policykit-1-gnome/polkit-gnome-authentication-agent-1 29144
-usr/bin/openpgp-applet 29143
-usr/lib/i386-linux-gnu/torsocks/libtorsocks.so.0.0.0 29142
-etc/tor/torsocks.conf 29141
-usr/lib/i386-linux-gnu/perl5/5.20/auto/XML/Parser/Expat/Expat.so 29140
-usr/lib/i386-linux-gnu/perl5/5.20/Glib.pm 29139
-usr/lib/i386-linux-gnu/tracker-1.0/libtracker-data.so.0.0.0 29138
-etc/xdg/menus/applications-merged/Tails.menu 29137
-usr/lib/python3/dist-packages/gi/_error.py 29136
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Glib/Glib.so 29135
-etc/tor/torrc 29134
-usr/share/applications/gnome-power-statistics.desktop 29133
-usr/lib/python3/dist-packages/gi/repository/__init__.py 29131
-usr/lib/i386-linux-gnu/perl5/5.20/Gtk2.pm 29130
-usr/local/sbin/restart-tor 29129
-usr/lib/python3/dist-packages/gi/importer.py 29128
-etc/NetworkManager/dispatcher.d/20-time.sh 29127
-usr/lib/i386-linux-gnu/perl5/5.20/Pango.pm 29126
-usr/lib/i386-linux-gnu/perl5/5.20/Cairo.pm 29125
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Cairo/Cairo.so 29124
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Pango/Pango.so 29123
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Gtk2/Gtk2.so 29122
-usr/share/nm-applet/info.ui 29121
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/ASyncReply.pm 29120
-usr/local/lib/tails-shell-library/gnome.sh 29119
-usr/lib/i386-linux-gnu/gstreamer1.0/gstreamer-1.0/gst-plugin-scanner 29118
-usr/lib/python3/dist-packages/gi/module.py 29117
-usr/lib/python3/dist-packages/gi/overrides/__init__.py 29116
-usr/lib/python3/dist-packages/gi/_constants.py 29115
-bin/tempfile 29114
-usr/lib/NetworkManager/nm-applet-migration-tool 29113
-usr/bin/tor 29112
-usr/share/applications/nm-connection-editor.desktop 29111
-usr/lib/i386-linux-gnu/libgnome-keyring.so.0.2.0 29110
-usr/share/applications/openjdk-7-policytool.desktop 29109
-usr/lib/python3/dist-packages/gi/types.py 29108
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgnl.so 29107
-usr/share/applications/orca.desktop 29106
-usr/lib/python3/dist-packages/gi/docstring.py 29105
-usr/share/applications/vim.desktop 29104
-bin/su 29103
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgst1394.so 29102
-usr/lib/i386-linux-gnu/libavc1394.so.0.3.0 29101
-usr/lib/i386-linux-gnu/tracker-1.0/libtracker-common.so.0.0.0 29100
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Annotation.pm 29099
-usr/bin/tail 29098
-usr/lib/python3/dist-packages/gi/_propertyhelper.py 29097
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockConnection.pm 29096
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Error.pm 29095
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockMessage.pm 29094
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockIterator.pm 29093
-usr/lib/i386-linux-gnu/librom1394.so.0.3.0 29092
-usr/lib/i386-linux-gnu/libiec61883.so.0.1.1 29091
-usr/lib/i386-linux-gnu/libraw1394.so.11.1.0 29090
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsta52dec.so 29089
-usr/lib/i386-linux-gnu/libgstaudio-1.0.so.0.404.0 29088
-usr/lib/i386-linux-gnu/liba52-0.7.4.so 29087
-etc/pam.d/su 29086
-usr/share/desktop-directories/ActionGames.directory 29085
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Value.pm 29084
-usr/lib/i386-linux-gnu/libgsttag-1.0.so.0.404.0 29083
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaasink.so 29082
-usr/lib/i386-linux-gnu/perl/5.20.2/Data/Dumper.pm 29080
-usr/lib/python3/dist-packages/gi/_signalhelper.py 29076
-usr/share/desktop-directories/AdventureGames.directory 29075
-usr/lib/i386-linux-gnu/libgstvideo-1.0.so.0.404.0 29074
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Data/Dumper/Dumper.so 29073
-usr/lib/python3.4/inspect.py 29072
-usr/share/desktop-directories/ArcadeGames.directory 29071
-usr/share/desktop-directories/AudioVideo.directory 29070
-usr/share/desktop-directories/BlocksGames.directory 29069
-usr/share/desktop-directories/BoardGames.directory 29068
-usr/share/desktop-directories/CardGames.directory 29067
-usr/share/desktop-directories/Debian.directory 29066
-usr/share/desktop-directories/Development.directory 29065
-usr/share/desktop-directories/Education.directory 29064
-usr/share/desktop-directories/Game.directory 29063
-usr/share/desktop-directories/GnomeScience.directory 29062
-usr/share/desktop-directories/Graphics.directory 29061
-usr/share/desktop-directories/KidsGames.directory 29060
-usr/share/desktop-directories/LogicGames.directory 29059
-usr/share/desktop-directories/Network.directory 29058
-usr/share/desktop-directories/Office.directory 29057
-usr/share/desktop-directories/RolePlayingGames.directory 29056
-usr/share/desktop-directories/Settings-System.directory 29055
-usr/share/desktop-directories/Settings.directory 29054
-usr/share/desktop-directories/SimulationGames.directory 29053
-usr/share/desktop-directories/SportsGames.directory 29052
-usr/share/desktop-directories/StrategyGames.directory 29051
-usr/share/desktop-directories/System-Tools.directory 29050
-usr/share/desktop-directories/Tails.directory 29049
-usr/share/desktop-directories/Utility-Accessibility.directory 29048
-usr/share/desktop-directories/Utility.directory 29047
-usr/share/desktop-directories/X-GNOME-Menu-Applications.directory 29046
-usr/share/desktop-directories/X-GNOME-Other.directory 29045
-usr/share/desktop-directories/X-GNOME-Sundry.directory 29044
-usr/share/desktop-directories/X-GNOME-SystemSettings.directory 29043
-usr/share/desktop-directories/X-GNOME-Utilities.directory 29042
-usr/share/desktop-directories/X-GNOME-WebApplications.directory 29041
-usr/lib/i386-linux-gnu/gconf/gconfd-2 29040
-lib/i386-linux-gnu/security/pam_mail.so 29039
-usr/lib/i386-linux-gnu/libaa.so.1.0.4 29038
-etc/gconf/gconf.xml.defaults/%gconf-tree.xml 29037
-usr/lib/python3.4/ast.py 29035
-usr/lib/python3.4/dis.py 29034
-lib/i386-linux-gnu/libslang.so.2.3.0 29033
-usr/share/perl5/Desktop/Notify/Notification.pm 29032
-usr/lib/python3.4/opcode.py 29031
-usr/lib/python3.4/lib-dynload/_opcode.cpython-34m-i386-linux-gnu.so 29030
-usr/lib/i386-linux-gnu/libunistring.so.0.1.2 29029
-var/lib/gconf/debian.defaults/%gconf-tree.xml 29028
-usr/lib/python3/dist-packages/gi/overrides/GLib.py 29027
-usr/local/lib/tor-browser/browser/icons/mozicon128.png 29026
-usr/lib/python3/dist-packages/gi/_option.py 29025
-usr/lib/python3.4/optparse.py 29024
-usr/lib/python3.4/textwrap.py 29023
-var/lib/gconf/defaults/%gconf-tree.xml 29022
-usr/lib/i386-linux-gnu/libevent-2.0.so.5.1.9 29021
-usr/lib/i386-linux-gnu/libseccomp.so.2.1.1 29020
-usr/share/perl5/Class/Accessor.pm 29019
-usr/local/lib/tails-htp-notify-user 29018
-usr/lib/i386-linux-gnu/libgtk-x11-2.0.so.0.2400.25 29017
-usr/lib/python3/dist-packages/gi/overrides/IBus.py 29016
-usr/share/perl5/URI.pm 29015
-usr/share/perl5/URI/Escape.pm 29014
-usr/share/perl5/IPC/System/Simple.pm 29013
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Reactor.pm 29012
-usr/lib/i386-linux-gnu/libgpm.so.2 29011
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Watch.pm 29010
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Callback.pm 29009
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaccurip.so 29008
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadder.so 29007
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadpcmdec.so 29006
-usr/lib/i386-linux-gnu/perl/5.20.2/Time/HiRes.pm 29005
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadpcmenc.so 29004
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaiff.so 29003
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalaw.so 29002
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Time/HiRes/HiRes.so 29001
-usr/bin/systemd-detect-virt 29000
-usr/share/icons/gnome/16x16/devices/network-wired.png 28999
-usr/share/icons/hicolor/32x32/apps/icedove.png 28998
-usr/share/icons/hicolor/32x32/apps/pidgin.png 28997
-usr/share/icons/hicolor/32x32/apps/keepassx.png 28996
-usr/share/icons/Adwaita/32x32/apps/utilities-terminal.png 28995
-usr/share/gnome-shell/extensions/auto-move-windows@gnome-shell-extensions.gcampax.github.com/metadata.json 28994
-usr/share/gnome-shell/extensions/drive-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 28993
-usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/metadata.json 28992
-usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/extension.js 28991
-usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28990
-usr/share/gnome-shell/extensions/native-window-placement@gnome-shell-extensions.gcampax.github.com/metadata.json 28989
-usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 28988
-usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/extension.js 28987
-usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/convenience.js 28986
-usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/placeDisplay.js 28985
-usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28984
-usr/share/gnome-shell/extensions/screenshot-window-sizer@gnome-shell-extensions.gcampax.github.com/metadata.json 28983
-usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/metadata.json 28982
-usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/extension.js 28981
-usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/lib.js 28980
-usr/share/gnome-shell/extensions/systemMonitor@gnome-shell-extensions.gcampax.github.com/metadata.json 28979
-usr/share/gnome-shell/extensions/topIcons@adel.gadllah@gmail.com/metadata.json 28978
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalpha.so 28977
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalphacolor.so 28976
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstamrnb.so 28975
-usr/lib/i386-linux-gnu/libopencore-amrnb.so.0.0.3 28974
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstamrwbdec.so 28973
-usr/lib/i386-linux-gnu/libopencore-amrwb.so.0.0.3 28972
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstapetag.so 28971
-usr/lib/i386-linux-gnu/libgstpbutils-1.0.so.0.404.0 28970
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstapp.so 28969
-usr/lib/i386-linux-gnu/libgstapp-1.0.so.0.404.0 28968
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstasf.so 28967
-usr/lib/i386-linux-gnu/libgstriff-1.0.so.0.404.0 28966
-usr/lib/i386-linux-gnu/libgstrtsp-1.0.so.0.404.0 28965
-usr/lib/i386-linux-gnu/libgstsdp-1.0.so.0.404.0 28964
-usr/share/gnome-shell/extensions/topIcons@adel.gadllah@gmail.com/extension.js 28963
-usr/share/gnome-shell/extensions/torstatus@tails.boum.org/metadata.json 28962
-usr/share/gnome-shell/extensions/torstatus@tails.boum.org/extension.js 28961
-usr/share/gnome-shell/extensions/user-theme@gnome-shell-extensions.gcampax.github.com/metadata.json 28960
-usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/metadata.json 28959
-usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/extension.js 28958
-usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/convenience.js 28957
-usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/classic.css 28956
-usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28955
-usr/share/gnome-shell/extensions/windowsNavigator@gnome-shell-extensions.gcampax.github.com/metadata.json 28954
-usr/share/gnome-shell/extensions/workspace-indicator@gnome-shell-extensions.gcampax.github.com/metadata.json 28953
-usr/lib/i386-linux-gnu/libgstrtp-1.0.so.0.404.0 28952
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstasfmux.so 28951
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstassrender.so 28950
-usr/lib/i386-linux-gnu/libass.so.5.0.0 28949
-usr/lib/i386-linux-gnu/libfribidi.so.0.3.5 28948
-usr/lib/i386-linux-gnu/libenca.so.0.5.1 28947
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioconvert.so 28946
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiofx.so 28945
-usr/lib/python3/dist-packages/gi/overrides/GObject.py 28944
-usr/lib/python3/dist-packages/gi/overrides/Gio.py 28943
-usr/share/fonts/truetype/dejavu/DejaVuSansMono.ttf 28942
-usr/share/ibus-anthy/engine/_config.py 28941
-usr/share/ibus-anthy/engine/factory.py 28940
-usr/share/ibus-anthy/engine/engine.py 28939
-usr/lib/girepository-1.0/Anthy-9000.typelib 28938
-usr/share/ibus-anthy/engine/tables.py 28937
-usr/share/ibus-anthy/engine/jastring.py 28936
-usr/share/ibus-anthy/engine/romaji.py 28935
-usr/share/ibus-anthy/engine/segment.py 28934
-usr/share/icons/hicolor/scalable/status/tor-disconnected-symbolic.svg 28933
-usr/share/gnome-shell/theme/classic-process-working.svg 28932
-usr/share/icons/Adwaita/scalable/apps/preferences-desktop-accessibility-symbolic.svg 28931
-usr/share/icons/Adwaita/scalable/actions/find-location-symbolic.svg 28930
-usr/lib/i386-linux-gnu/libgdk-x11-2.0.so.0.2400.25 28929
-usr/lib/i386-linux-gnu/libgstfft-1.0.so.0.404.0 28928
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiofxbad.so 28927
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiomixer.so 28926
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioparsers.so 28925
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiorate.so 28924
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioresample.so 28923
-usr/lib/i386-linux-gnu/liborc-test-0.4.so.0.22.0 28922
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiotestsrc.so 28921
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiovisualizers.so 28920
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstauparse.so 28919
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstautoconvert.so 28918
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstautodetect.so 28917
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstavi.so 28916
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstbayer.so 28915
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstbz2.so 28914
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcacasink.so 28913
-usr/lib/i386-linux-gnu/libcaca.so.0.99.19 28912
-lib/i386-linux-gnu/libncursesw.so.5.9 28911
-usr/share/ibus-anthy/engine/kana.py 28910
-usr/share/ibus-anthy/engine/thumb.py 28909
-usr/share/ibus-anthy/setup/anthyprefs.py 28908
-usr/share/ibus-anthy/setup/prefs.py 28907
-usr/share/ibus-anthy/engine/default.xml 28906
-usr/share/icons/gnome/24x24/status/dialog-information.png 28905
-usr/share/icons/Adwaita/scalable/actions/system-shutdown-symbolic.svg 28904
-usr/share/icons/Adwaita/scalable/status/user-available-symbolic.svg 28903
-usr/share/icons/Adwaita/scalable/devices/audio-speakers-symbolic.svg 28902
-usr/share/icons/Adwaita/scalable/status/audio-volume-medium-symbolic.svg 28901
-usr/share/ibus/component/dconf.xml 28900
-usr/share/ibus/component/gtkpanel.xml 28899
-usr/share/ibus/component/hangul.xml 28898
-usr/share/ibus/component/pinyin.xml 28897
-usr/share/ibus/component/simple.xml 28896
-usr/share/ibus/component/unikey.xml 28895
-usr/lib/ibus-unikey/ibus-engine-unikey 28894
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcairo.so 28893
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcamerabin2.so 28892
-usr/lib/i386-linux-gnu/libgstphotography-1.0.so.0.404.0 28891
-usr/lib/i386-linux-gnu/libgstbasecamerabinsrc-1.0.so.0.404.0 28890
-usr/lib/ibus/ibus-dconf 28889
-usr/lib/ibus/ibus-x11 28888
-etc/dconf/profile/ibus 28887
-etc/dconf/db/ibus 28886
-usr/share/tor/tor-service-defaults-torrc 28885
-usr/lib/nautilus/extensions-3.0/libevince-properties-page.so 28884
-usr/lib/libevdocument3.so.4.0.0 28883
-usr/lib/evince/4/backends/comicsdocument.evince-backend 28882
-usr/lib/evince/4/backends/djvudocument.evince-backend 28881
-usr/lib/evince/4/backends/dvidocument.evince-backend 28880
-usr/lib/evince/4/backends/pdfdocument.evince-backend 28879
-usr/lib/evince/4/backends/psdocument.evince-backend 28878
-usr/lib/evince/4/backends/tiffdocument.evince-backend 28877
-usr/lib/evince/4/backends/xpsdocument.evince-backend 28876
-usr/lib/nautilus/extensions-3.0/libgtkhash-properties.so 28875
-usr/lib/i386-linux-gnu/libmhash.so.2.0.1 28874
-usr/lib/nautilus/extensions-3.0/libnautilus-brasero-extension.so 28873
-usr/lib/libbrasero-utils3.so.1.2.6 28872
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcdio.so 28871
-usr/lib/libcdio.so.13.0.0 28870
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcdparanoia.so 28869
-usr/lib/i386-linux-gnu/libcdda_interface.so.0.10.2 28868
-usr/lib/i386-linux-gnu/libcdda_paranoia.so.0.10.2 28867
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstchromaprint.so 28866
-usr/lib/i386-linux-gnu/libchromaprint.so.0.2.3 28865
-usr/lib/i386-linux-gnu/i686/cmov/libavcodec.so.56.1.0 28864
-usr/share/tor/geoip 28863
-usr/lib/libbrasero-media3.so.1.2.6 28862
-usr/lib/libbrasero-burn3.so.1.2.6 28861
-usr/lib/libtotem-plparser.so.18.1.0 28860
-usr/lib/i386-linux-gnu/libgmime-2.6.so.0.620.0 28859
-usr/lib/i386-linux-gnu/libquvi.so.7.0.1 28858
-usr/lib/i386-linux-gnu/libarchive.so.13.1.2 28857
-usr/lib/i386-linux-gnu/libgpgme-pthread.so.11.13.0 28856
-usr/lib/i386-linux-gnu/libcurl-gnutls.so.4.3.0 28855
-usr/lib/i386-linux-gnu/liblua5.2.so.0.0.0 28854
-lib/i386-linux-gnu/liblzo2.so.2.0.0 28853
-usr/lib/i386-linux-gnu/i686/cmov/libavutil.so.54.3.0 28852
-usr/lib/i386-linux-gnu/i686/cmov/libavresample.so.2.1.0 28851
-usr/lib/i386-linux-gnu/libxvidcore.so.4.3 28850
-usr/lib/i386-linux-gnu/libidn.so.11.6.12 28849
-usr/lib/i386-linux-gnu/librtmp.so.1 28848
-usr/lib/i386-linux-gnu/libssh2.so.1.0.1 28847
-usr/lib/i386-linux-gnu/i686/sse2/libx264.so.142 28846
-usr/lib/i386-linux-gnu/liblber-2.4.so.2.10.3 28845
-usr/lib/i386-linux-gnu/libldap_r-2.4.so.2.10.3 28844
-usr/lib/i386-linux-gnu/libsasl2.so.2.0.25 28843
-usr/lib/nautilus/extensions-3.0/libnautilus-fileroller.so 28842
-usr/lib/nautilus/extensions-3.0/libnautilus-python.so 28841
-usr/lib/i386-linux-gnu/libpython2.7.so.1.0 28840
-usr/share/themes/Adwaita/gtk-2.0/gtkrc 28839
-usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/engines/libpixmap.so 28838
-usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/engines/libadwaita.so 28837
-usr/share/themes/Default/gtk-2.0-key/gtkrc 28836
-usr/lib/i386-linux-gnu/perl5/5.20/Gtk2/Gdk/Keysyms.pm 28835
-usr/lib/i386-linux-gnu/perl5/5.20/Gtk2/SimpleList.pm 28834
-usr/share/tor/geoip6 28833
-usr/share/perl5/Crypt/OpenPGP_Applet/GnuPG/Interface.pm 28832
-usr/share/perl5/namespace/autoclean.pm 28831
-usr/share/perl5/B/Hooks/EndOfScope.pm 28830
-usr/share/perl5/Module/Implementation.pm 28829
-usr/share/perl5/Try/Tiny.pm 28828
-usr/share/perl5/B/Hooks/EndOfScope/XS.pm 28827
-usr/lib/i386-linux-gnu/perl5/5.20/Variable/Magic.pm 28826
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Variable/Magic/Magic.so 28825
-usr/share/perl5/namespace/clean.pm 28824
-usr/share/perl5/Package/Stash.pm 28823
-usr/lib/i386-linux-gnu/perl5/5.20/Package/Stash/XS.pm 28822
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Package/Stash/XS/XS.so 28821
-usr/lib/i386-linux-gnu/perl5/5.20/Sub/Identify.pm 28820
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Sub/Identify/Identify.so 28819
-usr/lib/i386-linux-gnu/perl5/5.20/DateTime.pm 28818
-usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Duration.pm 28817
-usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Helpers.pm 28816
-usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate.pm 28815
-usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate/Constants.pm 28814
-usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate/XS.pm 28813
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Params/Validate/XS/XS.so 28812
-usr/share/perl5/DateTime/Locale.pm 28811
-usr/share/perl5/DateTime/Locale/Base.pm 28810
-usr/lib/python2.7/dist-packages/gi/_gobject/__init__.py 28809
-usr/lib/girepository-1.0/Nautilus-3.0.typelib 28808
-usr/share/perl5/DateTime/Locale/Catalog.pm 28807
-usr/lib/i386-linux-gnu/libvpx.so.1.3.0 28806
-usr/share/perl5/DateTime/TimeZone.pm 28805
-usr/share/perl5/DateTime/TimeZone/Catalog.pm 28804
-usr/share/perl5/DateTime/TimeZone/Floating.pm 28803
-usr/share/perl5/Class/Singleton.pm 28802
-usr/share/perl5/DateTime/TimeZone/OffsetOnly.pm 28801
-usr/share/perl5/DateTime/TimeZone/UTC.pm 28800
-usr/share/perl5/DateTime/TimeZone/Local.pm 28799
-usr/share/perl5/Class/Load.pm 28798
-usr/share/perl5/Data/OptList.pm 28797
-usr/lib/i386-linux-gnu/perl5/5.20/Params/Util.pm 28796
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Params/Util/Util.so 28795
-usr/share/perl5/Sub/Install.pm 28794
-usr/lib/i386-linux-gnu/perl5/5.20/Class/Load/XS.pm 28793
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Class/Load/XS/XS.so 28792
-usr/lib/i386-linux-gnu/perl5/5.20/auto/DateTime/DateTime.so 28791
-usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Infinite.pm 28790
-usr/share/nautilus-python/extensions/nautilus-mat.py 28789
-usr/share/perl5/DateTime/Locale/en_US.pm 28788
-usr/share/perl5/DateTime/Locale/en.pm 28787
-usr/share/perl5/DateTime/Locale/root.pm 28786
-usr/share/perl5/File/ShareDir.pm 28785
-usr/share/perl5/Class/Inspector.pm 28784
-usr/share/perl5/Locale/TextDomain.pm 28783
-usr/share/perl5/Locale/Messages.pm 28782
-usr/share/perl5/Locale/gettext_pp.pm 28781
-usr/share/perl5/Locale/Recode.pm 28780
-usr/share/perl5/Locale/Recode/_Conversions.pm 28779
-usr/lib/python2.7/dist-packages/MAT/__init__.py 28778
-usr/lib/python2.7/dist-packages/MAT/mat.py 28777
-usr/lib/python2.7/mimetypes.py 28776
-usr/share/icons/hicolor/36x36/emblems/emblem-debian.icon 28775
-usr/share/icons/hicolor/64x64/emblems/emblem-debian.icon 28774
-usr/share/icons/hicolor/128x128/emblems/emblem-debian.icon 28773
-usr/share/icons/hicolor/scalable/emblems/emblem-debian.icon 28772
-usr/lib/python2.7/xml/sax/__init__.py 28771
-usr/lib/python2.7/xml/sax/xmlreader.py 28770
-usr/lib/python2.7/xml/sax/handler.py 28769
-usr/lib/python2.7/xml/sax/_exceptions.py 28768
-usr/lib/python2.7/dist-packages/hachoir_core/__init__.py 28767
-usr/lib/python2.7/dist-packages/hachoir_core/version.py 28766
-usr/lib/python2.7/dist-packages/hachoir_core/cmd_line.py 28765
-usr/lib/python2.7/dist-packages/hachoir_core/log.py 28764
-usr/lib/python2.7/dist-packages/hachoir_core/config.py 28763
-usr/lib/python2.7/dist-packages/hachoir_core/i18n.py 28762
-usr/lib/python2.7/encodings/utf_32_be.py 28761
-usr/lib/python2.7/encodings/latin_1.py 28760
-usr/lib/python2.7/encodings/iso8859_15.py 28759
-usr/lib/python2.7/encodings/mac_roman.py 28758
-usr/lib/python2.7/encodings/iso8859_7.py 28757
-usr/lib/python2.7/dist-packages/hachoir_core/tools.py 28756
-usr/lib/python2.7/dist-packages/hachoir_parser/__init__.py 28755
-usr/lib/python2.7/dist-packages/hachoir_parser/version.py 28754
-usr/lib/python2.7/dist-packages/hachoir_parser/parser.py 28753
-usr/share/icons/hicolor/48x48/apps/seahorse.png 28752
-usr/share/perl5/auto/share/dist/OpenPGP_Applet/pixmaps/48x48/OpenPGP_Applet-text.png 28751
-usr/lib/python2.7/dist-packages/hachoir_core/field/__init__.py 28750
-usr/lib/python2.7/dist-packages/hachoir_core/field/field.py 28749
-usr/share/perl/5.20.2/feature.pm 28748
-usr/share/fonts/truetype/dejavu/DejaVuSansMono-Bold.ttf 28747
-usr/lib/python2.7/dist-packages/hachoir_core/compatibility.py 28746
-usr/lib/python2.7/dist-packages/hachoir_core/stream/__init__.py 28745
-usr/lib/python2.7/dist-packages/hachoir_core/endian.py 28744
-usr/lib/python2.7/dist-packages/hachoir_core/stream/stream.py 28743
-usr/lib/python2.7/dist-packages/hachoir_core/error.py 28742
-usr/lib/python2.7/dist-packages/hachoir_core/stream/input.py 28741
-usr/lib/python2.7/dist-packages/hachoir_core/bits.py 28740
-usr/lib/python2.7/dist-packages/hachoir_core/stream/input_helper.py 28739
-usr/lib/python2.7/dist-packages/hachoir_core/stream/output.py 28738
-usr/lib/python2.7/dist-packages/hachoir_core/field/bit_field.py 28737
-usr/lib/python2.7/dist-packages/hachoir_core/field/byte_field.py 28736
-usr/lib/python2.7/dist-packages/hachoir_core/field/sub_file.py 28735
-usr/lib/python2.7/dist-packages/hachoir_core/field/character.py 28734
-usr/lib/python2.7/dist-packages/hachoir_core/field/integer.py 28733
-usr/lib/python2.7/dist-packages/hachoir_core/field/enum.py 28732
-usr/lib/python2.7/dist-packages/hachoir_core/field/string_field.py 28731
-usr/lib/python2.7/dist-packages/hachoir_core/field/padding.py 28730
-usr/lib/python2.7/dist-packages/hachoir_core/field/helper.py 28729
-usr/lib/python2.7/dist-packages/hachoir_core/field/fake_array.py 28728
-usr/lib/python2.7/dist-packages/hachoir_core/field/basic_field_set.py 28727
-usr/lib/python2.7/dist-packages/hachoir_core/event_handler.py 28726
-usr/lib/python2.7/dist-packages/hachoir_core/field/generic_field_set.py 28725
-usr/lib/i386-linux-gnu/libtheoraenc.so.1.1.2 28724
-usr/lib/python2.7/dist-packages/hachoir_core/dict.py 28723
-usr/lib/i386-linux-gnu/libtheoradec.so.1.1.4 28722
-usr/lib/python2.7/dist-packages/hachoir_core/field/seekable_field_set.py 28721
-usr/lib/python2.7/dist-packages/hachoir_core/field/field_set.py 28720
-usr/lib/python2.7/dist-packages/hachoir_core/field/static_field_set.py 28719
-usr/lib/python2.7/dist-packages/hachoir_core/field/parser.py 28718
-usr/lib/python2.7/dist-packages/hachoir_core/field/vector.py 28717
-usr/lib/python2.7/dist-packages/hachoir_core/field/float.py 28716
-usr/lib/python2.7/dist-packages/hachoir_core/field/timestamp.py 28715
-usr/lib/python2.7/dist-packages/hachoir_core/field/link.py 28714
-usr/lib/python2.7/dist-packages/hachoir_parser/parser_list.py 28713
-usr/lib/python2.7/dist-packages/hachoir_parser/guess.py 28712
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/__init__.py 28711
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/ace.py 28710
-usr/lib/python2.7/dist-packages/hachoir_core/text_handler.py 28709
-usr/lib/python2.7/dist-packages/hachoir_parser/common/__init__.py 28708
-usr/lib/python2.7/dist-packages/hachoir_parser/common/msdos.py 28707
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/ar.py 28706
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/bzip2_parser.py 28705
-usr/lib/i386-linux-gnu/sse2/libspeex.so.1.5.0 28704
-usr/lib/i386-linux-gnu/libschroedinger-1.0.so.0.11.0 28703
-usr/lib/python2.7/lib-dynload/bz2.i386-linux-gnu.so 28702
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/cab.py 28701
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/gzip_parser.py 28700
-usr/lib/python2.7/dist-packages/hachoir_parser/common/deflate.py 28699
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/tar.py 28698
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/zip.py 28697
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/rar.py 28696
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/rpm.py 28695
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/sevenzip.py 28694
-usr/lib/python2.7/dist-packages/hachoir_parser/archive/mar.py 28693
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/__init__.py 28692
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/aiff.py 28691
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/id3.py 28690
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/au.py 28689
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/itunesdb.py 28688
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/midi.py 28687
-usr/lib/python2.7/dist-packages/hachoir_parser/common/tracker.py 28686
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/mpeg_audio.py 28685
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/real_audio.py 28684
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/xm.py 28683
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/modplug.py 28682
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/s3m.py 28681
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/mod.py 28680
-usr/lib/python2.7/dist-packages/hachoir_parser/audio/flac.py 28679
-usr/lib/python2.7/dist-packages/hachoir_parser/container/__init__.py 28678
-usr/lib/python2.7/dist-packages/hachoir_parser/container/asn1.py 28677
-usr/lib/python2.7/dist-packages/hachoir_parser/container/mkv.py 28676
-usr/lib/python2.7/dist-packages/hachoir_core/iso639.py 28675
-usr/lib/python2.7/dist-packages/hachoir_parser/container/ogg.py 28674
-usr/lib/python2.7/dist-packages/hachoir_parser/container/riff.py 28673
-usr/lib/python2.7/dist-packages/hachoir_parser/video/__init__.py 28672
-usr/lib/python2.7/dist-packages/hachoir_parser/video/asf.py 28671
-usr/lib/python2.7/dist-packages/hachoir_parser/video/fourcc.py 28670
-usr/lib/python2.7/dist-packages/hachoir_parser/common/win32.py 28669
-usr/lib/python2.7/dist-packages/hachoir_parser/network/__init__.py 28668
-usr/lib/python2.7/dist-packages/hachoir_parser/network/tcpdump.py 28667
-usr/lib/python2.7/dist-packages/hachoir_parser/network/common.py 28666
-usr/lib/python2.7/dist-packages/hachoir_parser/network/ouid.py 28665
-usr/lib/i386-linux-gnu/libopus.so.0.5.0 28664
-usr/share/X11/xkb/symbols/kr 28663
-usr/lib/i386-linux-gnu/libopenjpeg.so.1.5.2 28662
-usr/lib/i386-linux-gnu/libmp3lame.so.0.0.0 28661
-usr/lib/i386-linux-gnu/libgsm.so.1.0.12 28660
-usr/lib/i386-linux-gnu/libva.so.1.3600.0 28659
-usr/lib/python2.7/dist-packages/hachoir_parser/video/flv.py 28658
-usr/lib/ibus/ibus-engine-simple 28657
-usr/lib/python2.7/dist-packages/hachoir_parser/video/amf.py 28656
-usr/lib/python2.7/dist-packages/hachoir_parser/video/mov.py 28655
-usr/lib/python2.7/dist-packages/hachoir_parser/video/mpeg_video.py 28654
-usr/lib/python2.7/dist-packages/hachoir_parser/video/mpeg_ts.py 28653
-usr/lib/python2.7/dist-packages/hachoir_parser/image/__init__.py 28652
-usr/lib/python2.7/dist-packages/hachoir_parser/image/bmp.py 28651
-usr/lib/python2.7/dist-packages/hachoir_parser/image/common.py 28650
-usr/lib/python2.7/dist-packages/hachoir_parser/image/gif.py 28649
-usr/lib/python2.7/dist-packages/hachoir_parser/image/ico.py 28648
-usr/lib/python2.7/dist-packages/hachoir_parser/image/jpeg.py 28647
-usr/lib/python2.7/dist-packages/hachoir_parser/image/exif.py 28646
-usr/lib/python2.7/dist-packages/hachoir_parser/image/photoshop_metadata.py 28645
-usr/lib/python2.7/dist-packages/hachoir_parser/image/iptc.py 28644
-usr/lib/python2.7/dist-packages/hachoir_parser/image/pcx.py 28643
-usr/lib/python2.7/dist-packages/hachoir_parser/image/psd.py 28642
-usr/lib/python2.7/dist-packages/hachoir_parser/image/png.py 28641
-usr/lib/python2.7/dist-packages/hachoir_parser/image/tga.py 28640
-usr/lib/python2.7/dist-packages/hachoir_parser/image/tiff.py 28639
-usr/lib/python2.7/dist-packages/hachoir_parser/image/wmf.py 28638
-usr/lib/python2.7/dist-packages/hachoir_parser/image/xcf.py 28637
-usr/lib/python2.7/dist-packages/hachoir_parser/container/swf.py 28636
-usr/lib/python2.7/dist-packages/hachoir_parser/container/action_script.py 28635
-usr/lib/python2.7/dist-packages/hachoir_parser/container/realmedia.py 28634
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/__init__.py 28633
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/ext2.py 28632
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/fat.py 28631
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/mbr.py 28630
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/ntfs.py 28629
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/iso9660.py 28628
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/reiser_fs.py 28627
-usr/lib/python2.7/dist-packages/hachoir_parser/file_system/linux_swap.py 28626
-usr/lib/python2.7/dist-packages/hachoir_parser/game/__init__.py 28625
-usr/lib/python2.7/dist-packages/hachoir_parser/game/zsnes.py 28624
-usr/lib/python2.7/dist-packages/hachoir_parser/game/spider_man_video.py 28623
-usr/lib/python2.7/dist-packages/hachoir_parser/game/laf.py 28622
-usr/lib/python2.7/dist-packages/hachoir_parser/game/blp.py 28621
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/__init__.py 28620
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/file_3do.py 28619
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/common.py 28618
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/file_3ds.py 28617
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/torrent.py 28616
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/ttf.py 28615
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/chm.py 28614
-usr/lib/python2.7/dist-packages/hachoir_parser/common/win32_lang_id.py 28613
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/lnk.py 28612
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/pcf.py 28611
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/ole2.py 28610
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/msoffice.py 28609
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/msoffice_summary.py 28608
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/word_doc.py 28607
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/pdf.py 28606
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/pifv.py 28605
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/hlp.py 28604
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/gnome_keyring.py 28603
-usr/lib/python2.7/dist-packages/hachoir_parser/misc/bplist.py 28602
-usr/lib/python2.7/dist-packages/hachoir_parser/program/__init__.py 28601
-usr/lib/python2.7/dist-packages/hachoir_parser/program/elf.py 28600
-usr/lib/python2.7/dist-packages/hachoir_parser/program/exe.py 28599
-usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_ne.py 28598
-usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_pe.py 28597
-usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_res.py 28596
-usr/lib/python2.7/dist-packages/hachoir_parser/program/python.py 28595
-usr/lib/python2.7/dist-packages/hachoir_parser/program/java.py 28594
-usr/lib/python2.7/dist-packages/hachoir_parser/program/prc.py 28593
-usr/share/fonts/truetype/arphic/ukai.ttc 28592
-usr/lib/python2.7/dist-packages/MAT/exceptions.py 28591
-usr/lib/python2.7/dist-packages/MAT/strippers.py 28590
-usr/lib/python2.7/dist-packages/MAT/archive.py 28589
-usr/lib/python2.7/tarfile.py 28588
-usr/lib/python2.7/dist-packages/MAT/parser.py 28587
-usr/lib/python2.7/dist-packages/MAT/hachoir_editor/__init__.py 28586
-usr/lib/python2.7/dist-packages/MAT/hachoir_editor/field.py 28585
-usr/lib/python2.7/dist-packages/MAT/hachoir_editor/typed_field.py 28584
-usr/lib/python2.7/dist-packages/MAT/hachoir_editor/fieldset.py 28583
-usr/lib/python2.7/dist-packages/MAT/audio.py 28582
-usr/lib/python2.7/dist-packages/mutagen/__init__.py 28581
-usr/lib/python2.7/dist-packages/mutagen/_util.py 28580
-usr/lib/python2.7/dist-packages/mutagen/_compat.py 28579
-usr/lib/python2.7/StringIO.py 28578
-usr/lib/python2.7/dist-packages/mutagen/_file.py 28577
-usr/lib/python2.7/dist-packages/mutagen/_tags.py 28576
-usr/lib/python2.7/dist-packages/mutagen/flac.py 28575
-usr/lib/python2.7/dist-packages/mutagen/_vorbis.py 28574
-usr/lib/python2.7/dist-packages/mutagen/id3/__init__.py 28573
-usr/lib/python2.7/dist-packages/mutagen/id3/_util.py 28572
-usr/lib/python2.7/dist-packages/mutagen/id3/_frames.py 28571
-usr/lib/python2.7/dist-packages/mutagen/id3/_specs.py 28570
-usr/lib/python2.7/dist-packages/mutagen/_constants.py 28569
-usr/lib/python2.7/dist-packages/mutagen/oggvorbis.py 28568
-usr/lib/python2.7/dist-packages/mutagen/ogg.py 28567
-usr/lib/python2.7/dist-packages/MAT/mutagenstripper.py 28566
-usr/lib/python2.7/dist-packages/MAT/images.py 28565
-usr/lib/python2.7/dist-packages/MAT/misc.py 28564
-usr/lib/python2.7/dist-packages/MAT/bencode/__init__.py 28563
-usr/lib/python2.7/dist-packages/MAT/bencode/bencode.py 28562
-usr/lib/python2.7/dist-packages/MAT/office.py 28561
-usr/share/pyshared/cairo/__init__.py 28560
-usr/lib/pyshared/python2.7/cairo/_cairo.so 28559
-usr/lib/girepository-1.0/Poppler-0.18.typelib 28558
-usr/bin/exiftool 28557
-usr/share/perl5/Image/ExifTool.pm 28556
-usr/share/perl5/File/RandomAccess.pm 28555
-usr/share/perl5/Image/ExifTool/Exif.pm 28554
-usr/share/perl5/Image/ExifTool/MakerNotes.pm 28553
-usr/lib/python2.7/dist-packages/MAT/exiftool.py 28552
-usr/lib/nautilus/extensions-3.0/libnautilus-seahorse.so 28551
-usr/lib/nautilus/extensions-3.0/libnautilus-sendto.so 28550
-usr/lib/nautilus/extensions-3.0/libnautilus-wipe.so 28549
-usr/lib/libgsecuredelete.so.0.0.0 28548
-usr/lib/nautilus/extensions-3.0/libterminal-nautilus.so 28547
-usr/lib/nautilus/extensions-3.0/libtotem-properties-page.so 28546
-usr/lib/gvfs/gvfsd-trash 28545
-usr/share/icons/Adwaita/scalable/actions/list-add-symbolic.svg 28544
-usr/share/icons/Adwaita/cursors/top_left_corner 28543
-usr/share/icons/Adwaita/cursors/top_side 28542
-usr/share/icons/Adwaita/cursors/top_right_corner 28541
-usr/share/icons/Adwaita/cursors/left_side 28540
-usr/share/icons/Adwaita/cursors/right_side 28539
-usr/share/icons/Adwaita/cursors/bottom_left_corner 28538
-usr/share/icons/Adwaita/cursors/bottom_side 28537
-usr/share/icons/Adwaita/cursors/bottom_right_corner 28536
-usr/share/icons/Adwaita/22x22/apps/system-file-manager.png 28535
-usr/share/icons/Adwaita/16x16/apps/system-file-manager.png 28534
-usr/share/icons/Adwaita/24x24/apps/system-file-manager.png 28533
-usr/share/icons/Adwaita/32x32/apps/system-file-manager.png 28532
-usr/share/icons/Adwaita/256x256/apps/system-file-manager.png 28531
-usr/share/icons/Adwaita/48x48/apps/system-file-manager.png 28530
-usr/lib/gvfs/gvfsd-burn 28529
-usr/share/icons/gnome/16x16/actions/edit-clear.png 28528
-usr/share/icons/Adwaita/16x16/apps/utilities-terminal.png 28527
-usr/share/icons/Adwaita/cursors/sb_h_double_arrow 28526
-usr/share/icons/Adwaita/48x48/places/user-home.png 28525
-usr/share/pixmaps/whisperback.svg 28524
-usr/share/icons/gnome/48x48/categories/system-help.png 28523
-usr/share/icons/Adwaita/48x48/places/user-trash.png 28522
-usr/lib/gvfs/gvfsd-metadata 28521
-usr/bin/sort 28520
-lib/systemd/system/htpdate.service 28519
-etc/default/htpdate.pools 28518
-etc/default/htpdate.user-agent 28517
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstclutter.so 28516
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcoloreffects.so 28515
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcompositor.so 28514
-usr/lib/i386-linux-gnu/libgstbadvideo-1.0.so.0.404.0 28513
-usr/lib/i386-linux-gnu/libgstbadbase-1.0.so.0.404.0 28512
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcoreelements.so 28511
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcurl.so 28510
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcutter.so 28509
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdashdemux.so 28508
-usr/local/bin/tails-upgrade-frontend-wrapper 28506
-usr/lib/i386-linux-gnu/libgsturidownloader-1.0.so.0.404.0 28505
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdataurisrc.so 28504
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdebug.so 28503
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdebugutilsbad.so 28502
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdecklink.so 28501
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdeinterlace.so 28500
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdtmf.so 28499
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdtsdec.so 28498
-usr/lib/i386-linux-gnu/libdca.so.0.0.0 28497
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdv.so 28496
-usr/lib/i386-linux-gnu/libdv.so.4.0.3 28495
-usr/local/bin/tails-security-check 28494
-usr/share/perl5/Carp/Assert/More.pm 28493
-usr/share/perl5/Carp/Assert.pm 28492
-usr/local/sbin/htpdate 28491
-usr/share/perl5/Tails/Download/HTTPS.pm 28490
-usr/share/perl5/DateTime/Format/DateParse.pm 28489
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvb.so 28488
-usr/lib/i386-linux-gnu/libgstmpegts-1.0.so.0.404.0 28487
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvbsuboverlay.so 28486
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdlpcmdec.so 28485
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdread.so 28484
-usr/lib/i386-linux-gnu/libdvdread.so.4.1.2 28483
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdspu.so 28482
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdsub.so 28481
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsteffectv.so 28480
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstencodebin.so 28479
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstequalizer.so 28478
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfaad.so 28477
-usr/lib/i386-linux-gnu/libfaad.so.2.0.0 28476
-usr/share/perl5/Date/Parse.pm 28475
-usr/share/perl/5.20.2/Time/Local.pm 28474
-usr/share/perl5/Time/Zone.pm 28473
-usr/share/perl5/Getopt/Long/Descriptive.pm 28472
-usr/share/perl5/Getopt/Long/Descriptive/Opts.pm 28471
-usr/share/perl5/Getopt/Long/Descriptive/Usage.pm 28470
-usr/share/perl5/Sub/Exporter/Util.pm 28469
-usr/share/perl5/Sub/Exporter.pm 28468
-usr/share/perl/5.20.2/open.pm 28467
-usr/lib/i386-linux-gnu/perl/5.20.2/threads.pm 28466
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/threads/threads.so 28465
-usr/bin/curl 28464
-usr/lib/i386-linux-gnu/libcurl.so.4.3.0 28463
-usr/lib/i386-linux-gnu/perl5/5.20/Moose.pm 28462
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfbdevsink.so 28461
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfestival.so 28460
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfieldanalysis.so 28459
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflac.so 28458
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflite.so 28457
-usr/lib/i386-linux-gnu/libflite.so.1.4 28456
-usr/lib/i386-linux-gnu/libflite_cmu_us_kal.so.1.4 28455
-usr/share/ca-certificates/mozilla/DigiCert_High_Assurance_EV_Root_CA.crt 28454
-usr/share/ca-certificates/mozilla/VeriSign_Class_3_Public_Primary_Certification_Authority_-_G5.crt 28453
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Deprecated.pm 28452
-usr/share/perl5/Package/DeprecationManager.pm 28451
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Exporter.pm 28450
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP.pm 28449
-usr/share/perl5/MRO/Compat.pm 28448
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/AttributeCore.pm 28447
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin.pm 28446
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/HasAttributes.pm 28445
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/HasMethods.pm 28444
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Meta.pm 28443
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method.pm 28442
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Object.pm 28441
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Overload.pm 28440
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Class.pm 28439
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Instance.pm 28438
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Wrapped.pm 28437
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Accessor.pm 28436
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Generated.pm 28435
-usr/share/perl5/Eval/Closure.pm 28434
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Constructor.pm 28433
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Inlined.pm 28432
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/MiniTrait.pm 28431
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Module.pm 28430
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Package.pm 28429
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Attribute.pm 28428
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Moose/Moose.so 28427
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Deprecated.pm 28426
-usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Class/Immutable/Trait.pm 28425
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/MetaRole.pm 28424
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util.pm 28423
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Class.pm 28422
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Overridden.pm 28421
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method.pm 28420
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Object/Trait.pm 28419
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Augmented.pm 28418
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Class/Immutable/Trait.pm 28417
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Constructor.pm 28416
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Destructor.pm 28415
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Meta.pm 28414
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint.pm 28413
-usr/lib/i386-linux-gnu/perl5/5.20/metaclass.pm 28412
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeCoercion.pm 28411
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute.pm 28410
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor.pm 28409
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Delegation.pm 28408
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/TypeConstraints.pm 28407
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Union.pm 28406
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeCoercion/Union.pm 28405
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Parameterized.pm 28404
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Parameterizable.pm 28403
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Class.pm 28402
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Role.pm 28401
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Enum.pm 28400
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/DuckType.pm 28399
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Registry.pm 28398
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/TypeConstraints/Builtins.pm 28397
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Mixin/AttributeCore.pm 28396
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Instance.pm 28395
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Object.pm 28394
-usr/share/perl/5.20.2/if.pm 28393
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role.pm 28392
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Attribute.pm 28391
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method.pm 28390
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method/Required.pm 28389
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method/Conflicting.pm 28388
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Composite.pm 28387
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application.pm 28386
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/RoleSummation.pm 28385
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToClass.pm 28384
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToRole.pm 28383
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToInstance.pm 28382
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native.pm 28381
-usr/share/perl5/MooseX/Method/Signatures.pm 28380
-usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare.pm 28379
-usr/lib/i386-linux-gnu/perl5/5.20/B/Hooks/OP/Check.pm 28378
-usr/lib/i386-linux-gnu/perl5/5.20/auto/B/Hooks/OP/Check/Check.so 28377
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Devel/Declare/Declare.so 28376
-usr/share/perl5/MooseX/LazyRequire.pm 28375
-usr/share/perl5/aliased.pm 28374
-usr/share/perl5/MooseX/LazyRequire/Meta/Attribute/Trait/LazyRequire.pm 28373
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Role.pm 28372
-usr/share/perl5/MooseX/Types/Moose.pm 28371
-usr/share/perl5/MooseX/Types.pm 28370
-usr/share/perl5/MooseX/Types/TypeDecorator.pm 28369
-usr/share/ca-certificates/mozilla/DigiCert_Global_Root_CA.crt 28368
-usr/share/perl5/Carp/Clan.pm 28367
-usr/share/perl5/MooseX/Types/Base.pm 28366
-usr/share/perl5/MooseX/Types/Util.pm 28365
-usr/share/perl5/MooseX/Types/UndefinedType.pm 28364
-usr/share/perl5/MooseX/Types/CheckedUtilExports.pm 28363
-usr/share/perl5/MooseX/Method/Signatures/Meta/Method.pm 28362
-usr/share/perl5/Context/Preserve.pm 28361
-usr/share/perl5/Parse/Method/Signatures.pm 28360
-usr/share/perl5/PPI.pm 28359
-usr/share/perl5/PPI/Util.pm 28358
-usr/lib/i386-linux-gnu/perl/5.20.2/Digest/MD5.pm 28357
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Digest/MD5/MD5.so 28356
-usr/share/perl5/PPI/Exception.pm 28355
-usr/share/perl5/PPI/Element.pm 28354
-usr/lib/i386-linux-gnu/perl5/5.20/Clone.pm 28353
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Clone/Clone.so 28352
-usr/share/perl5/PPI/Node.pm 28351
-usr/share/perl5/PPI/Token.pm 28350
-usr/share/perl5/PPI/Token/BOM.pm 28349
-usr/share/perl5/PPI/Token/Whitespace.pm 28348
-usr/share/perl5/PPI/Token/Comment.pm 28347
-usr/share/perl5/PPI/Token/Pod.pm 28346
-usr/share/perl5/PPI/Token/Number.pm 28345
-usr/share/perl5/PPI/Token/Number/Binary.pm 28344
-usr/share/perl5/PPI/Token/Number/Octal.pm 28343
-usr/share/perl5/PPI/Token/Number/Hex.pm 28342
-usr/share/perl5/PPI/Token/Number/Float.pm 28341
-usr/share/perl5/PPI/Token/Number/Exp.pm 28340
-usr/share/perl5/PPI/Token/Number/Version.pm 28339
-usr/share/perl5/PPI/Token/Word.pm 28338
-usr/share/perl5/PPI/Token/DashedWord.pm 28337
-usr/share/perl5/PPI/Token/Symbol.pm 28336
-usr/share/perl5/PPI/Token/ArrayIndex.pm 28335
-usr/share/perl5/PPI/Token/Magic.pm 28334
-usr/share/perl5/PPI/Token/Unknown.pm 28333
-usr/share/perl5/PPI/Token/Quote/Single.pm 28332
-usr/share/perl5/PPI/Token/Quote.pm 28331
-usr/share/perl5/PPI/Token/_QuoteEngine/Simple.pm 28330
-usr/share/perl5/PPI/Token/_QuoteEngine.pm 28329
-usr/share/perl5/PPI/Token/Quote/Double.pm 28328
-usr/share/perl5/PPI/Token/Quote/Literal.pm 28327
-usr/share/perl5/PPI/Token/_QuoteEngine/Full.pm 28326
-usr/share/perl5/PPI/Token/Quote/Interpolate.pm 28325
-usr/share/perl5/PPI/Token/QuoteLike/Backtick.pm 28324
-usr/share/perl5/PPI/Token/QuoteLike.pm 28323
-usr/share/perl5/PPI/Token/QuoteLike/Command.pm 28322
-usr/share/perl5/PPI/Token/QuoteLike/Regexp.pm 28321
-usr/share/perl5/PPI/Token/QuoteLike/Words.pm 28320
-usr/share/perl5/PPI/Token/QuoteLike/Readline.pm 28319
-usr/share/perl5/PPI/Token/Regexp/Match.pm 28318
-usr/share/perl5/PPI/Token/Regexp.pm 28317
-usr/share/perl5/PPI/Token/Regexp/Substitute.pm 28316
-usr/share/perl5/PPI/Token/Regexp/Transliterate.pm 28315
-usr/share/perl5/PPI/Token/Operator.pm 28314
-usr/share/perl5/PPI/Token/Cast.pm 28313
-usr/share/perl5/PPI/Token/Structure.pm 28312
-usr/share/perl5/PPI/Token/Label.pm 28311
-usr/share/perl5/PPI/Token/HereDoc.pm 28310
-usr/share/perl5/PPI/Token/Separator.pm 28309
-usr/share/perl5/PPI/Token/Data.pm 28308
-usr/share/perl5/IO/String.pm 28307
-usr/share/perl5/PPI/Token/End.pm 28306
-usr/share/perl5/PPI/Token/Prototype.pm 28305
-usr/share/perl5/PPI/Token/Attribute.pm 28304
-usr/share/perl5/PPI/Statement.pm 28303
-usr/share/perl5/PPI/Statement/Break.pm 28302
-usr/share/perl5/PPI/Statement/Compound.pm 28301
-usr/share/perl5/PPI/Statement/Data.pm 28300
-usr/share/perl5/PPI/Statement/End.pm 28299
-usr/share/perl5/PPI/Statement/Expression.pm 28298
-usr/share/perl5/PPI/Statement/Include.pm 28297
-usr/share/perl5/PPI/Statement/Include/Perl6.pm 28296
-usr/share/perl5/PPI/Statement/Null.pm 28295
-usr/share/perl5/PPI/Statement/Package.pm 28294
-usr/share/perl5/PPI/Statement/Scheduled.pm 28293
-usr/share/perl5/PPI/Statement/Sub.pm 28292
-usr/share/perl5/PPI/Statement/Given.pm 28291
-usr/share/perl5/PPI/Statement/UnmatchedBrace.pm 28290
-usr/share/perl5/PPI/Statement/Unknown.pm 28289
-usr/share/perl5/PPI/Statement/Variable.pm 28288
-usr/share/perl5/PPI/Statement/When.pm 28287
-usr/share/perl5/PPI/Structure.pm 28286
-usr/share/perl5/PPI/Structure/Block.pm 28285
-usr/share/perl5/PPI/Structure/Condition.pm 28284
-usr/share/perl5/PPI/Structure/Constructor.pm 28283
-usr/share/perl5/PPI/Structure/For.pm 28282
-usr/share/perl5/PPI/Structure/Given.pm 28281
-usr/share/perl5/PPI/Structure/List.pm 28280
-usr/share/perl5/PPI/Structure/Subscript.pm 28279
-usr/share/perl5/PPI/Structure/Unknown.pm 28278
-usr/share/perl5/PPI/Structure/When.pm 28277
-usr/share/perl5/PPI/Document.pm 28276
-usr/share/perl5/PPI/Exception/ParserTimeout.pm 28275
-usr/share/perl5/PPI/Document/Fragment.pm 28274
-usr/share/perl5/PPI/Document/File.pm 28273
-usr/share/perl5/PPI/Document/Normalized.pm 28272
-usr/share/perl5/PPI/Normal.pm 28271
-usr/share/perl5/PPI/Normal/Standard.pm 28270
-usr/share/perl5/PPI/Tokenizer.pm 28269
-usr/share/perl5/PPI/Exception/ParserRejection.pm 28268
-usr/share/perl5/PPI/Lexer.pm 28267
-usr/share/perl5/Parse/Method/Signatures/ParamCollection.pm 28266
-usr/share/perl5/Parse/Method/Signatures/Types.pm 28265
-usr/share/perl5/Parse/Method/Signatures/TypeConstraint.pm 28264
-usr/share/perl5/MooseX/Meta/TypeConstraint/ForceCoercion.pm 28263
-usr/share/perl5/MooseX/Types/Structured.pm 28262
-usr/share/perl5/MooseX/Meta/TypeConstraint/Structured.pm 28261
-usr/share/perl5/Devel/PartialDump.pm 28260
-usr/share/perl5/Class/Tiny.pm 28259
-usr/share/perl/5.20.2/unicore/lib/Perl/Print.pl 28258
-usr/share/perl5/MooseX/Meta/TypeCoercion/Structured.pm 28257
-usr/share/perl5/MooseX/Meta/TypeConstraint/Structured/Optional.pm 28256
-usr/share/perl5/MooseX/Meta/TypeCoercion/Structured/Optional.pm 28255
-usr/share/perl5/MooseX/Types/Structured/OverflowHandler.pm 28254
-usr/share/perl5/MooseX/Types/Structured/MessageStack.pm 28253
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait/Counter.pm 28252
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait.pm 28251
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Counter/dec.pm 28250
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Writer.pm 28249
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native.pm 28248
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Counter/inc.pm 28247
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait/Array.pm 28246
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/push.pm 28245
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/Writer.pm 28244
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array.pm 28243
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Collection.pm 28242
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/elements.pm 28241
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Reader.pm 28240
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/count.pm 28239
-usr/share/perl5/MooseX/Method/Signatures/Types.pm 28238
-usr/share/perl5/Parse/Method/Signatures/Param/Named.pm 28237
-usr/share/perl5/Parse/Method/Signatures/Param/Placeholder.pm 28236
-usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare/Context/Simple.pm 28235
-usr/share/perl5/MooseX/Has/Sugar/Saccharin.pm 28234
-usr/share/perl/5.20.2/autodie.pm 28233
-usr/share/perl/5.20.2/autodie/exception/system.pm 28232
-usr/share/perl/5.20.2/autodie/exception.pm 28231
-usr/lib/i386-linux-gnu/perl5/5.20/WWW/Curl/Easy.pm 28230
-usr/lib/i386-linux-gnu/perl5/5.20/WWW/Curl.pm 28229
-usr/lib/i386-linux-gnu/perl5/5.20/auto/WWW/Curl/Curl.so 28228
-usr/share/perl5/Parse/Method/Signatures/Sig.pm 28227
-usr/share/perl5/Parse/Method/Signatures/Param.pm 28226
-usr/share/perl5/MooseX/Traits.pm 28225
-usr/share/perl5/MooseX/Traits/Util.pm 28224
-usr/share/perl5/Parse/Method/Signatures/Param/Positional.pm 28223
-usr/share/perl5/Parse/Method/Signatures/Param/Bindable.pm 28222
-etc/NetworkManager/dispatcher.d/30-i2p.sh 28221
-usr/share/perl5/XML/Atom.pm 28220
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML.pm 28219
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Error.pm 28218
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/NodeList.pm 28217
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Boolean.pm 28216
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Number.pm 28215
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Literal.pm 28214
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/XPathContext.pm 28213
-usr/lib/i386-linux-gnu/perl5/5.20/auto/XML/LibXML/LibXML.so 28212
-usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/AttributeHash.pm 28211
-usr/share/perl5/XML/SAX/Exception.pm 28210
-usr/share/perl5/XML/Atom/ErrorHandler.pm 28209
-usr/share/perl5/XML/Atom/Feed.pm 28208
-usr/share/perl5/XML/Atom/Thing.pm 28207
-usr/share/perl5/XML/Atom/Base.pm 28206
-usr/share/perl5/Class/Data/Inheritable.pm 28205
-usr/share/perl5/XML/Atom/Util.pm 28204
-usr/share/perl5/XML/Atom/Category.pm 28203
-usr/share/perl5/XML/Atom/Link.pm 28202
-usr/share/perl5/LWP/UserAgent.pm 28201
-usr/share/perl5/HTTP/Request.pm 28200
-usr/share/perl5/HTTP/Message.pm 28199
-usr/share/perl5/HTTP/Headers.pm 28198
-usr/lib/i386-linux-gnu/perl/5.20.2/Storable.pm 28197
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Storable/Storable.so 28196
-usr/share/perl5/HTTP/Response.pm 28195
-usr/share/perl5/HTTP/Status.pm 28194
-usr/share/perl5/HTTP/Date.pm 28193
-usr/share/perl5/LWP.pm 28192
-usr/share/perl5/LWP/Protocol.pm 28191
-usr/share/perl5/LWP/MemberMixin.pm 28190
-usr/share/perl5/XML/Atom/Entry.pm 28189
-usr/share/perl5/XML/Atom/Person.pm 28188
-usr/share/perl5/XML/Atom/Content.pm 28187
-etc/NetworkManager/dispatcher.d/60-tor-ready.sh 28186
-usr/local/sbin/tor-has-bootstrapped 28185
-usr/local/etc/ssl/certs/tails.boum.org-CA.pem 28184
-usr/bin/gettext 28183
-usr/local/sbin/tails-notify-user 28182
-etc/NetworkManager/dispatcher.d/60-ttdnsd.sh 28181
-usr/sbin/service 28179
-etc/default/ttdnsd 28178
-usr/lib/i386-linux-gnu/libflite_usenglish.so.1.4 28177
-usr/lib/i386-linux-gnu/libflite_cmulex.so.1.4 28176
-usr/sbin/ttdnsd 28175
-usr/lib/libtsocks.so.1.8 28174
-etc/ttdnsd.conf 28173
-etc/NetworkManager/dispatcher.d/70-upgrade-additional-software.sh 28172
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfluidsynthmidi.so 28171
-usr/lib/i386-linux-gnu/libfluidsynth.so.1.5.2 28170
-usr/lib/i386-linux-gnu/libjack.so.0.1.0 28169
-usr/share/fonts/truetype/unifont/unifont.ttf 28168
-usr/lib/i386-linux-gnu/libpulse-simple.so.0.1.0 28167
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflv.so 28166
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflxdec.so 28165
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfragmented.so 28164
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfreeverb.so 28163
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfrei0r.so 28162
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgaudieffects.so 28161
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgdkpixbuf.so 28160
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgdp.so 28159
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgeometrictransform.so 28158
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgio.so 28157
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgme.so 28156
-usr/lib/libgme.so.0.5.3 28155
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgoom.so 28154
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgoom2k1.so 28153
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgsm.so 28152
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsticydemux.so 28151
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstid3demux.so 28150
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstid3tag.so 28149
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstimagefreeze.so 28148
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinter.so 28147
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinterlace.so 28146
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinterleave.so 28145
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstisomp4.so 28144
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstivfparse.so 28143
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstivtc.so 28142
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjack.so 28141
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjp2kdecimator.so 28140
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjpeg.so 28139
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjpegformat.so 28138
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstkate.so 28137
-usr/lib/libkate.so.1.3.0 28136
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstladspa.so 28135
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlame.so 28134
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlevel.so 28133
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlibav.so 28132
-usr/lib/i386-linux-gnu/i686/cmov/libavformat.so.56.1.0 28131
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlibvisual.so 28130
-usr/lib/i386-linux-gnu/libvisual-0.4.so.0.0.0 28129
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstliveadder.so 28128
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmad.so 28127
-usr/lib/i386-linux-gnu/libmad.so.0.2.1 28126
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmatroska.so 28125
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmidi.so 28124
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmimic.so 28123
-usr/lib/libmimic.so.0.0.1 28122
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmms.so 28121
-usr/lib/i386-linux-gnu/libmms.so.0.0.2 28120
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmodplug.so 28119
-usr/lib/libmodplug.so.1.0.0 28118
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmonoscope.so 28117
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpeg2dec.so 28116
-usr/lib/i386-linux-gnu/libmpeg2.so.0.1.0 28115
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpeg2enc.so 28114
-usr/lib/i386-linux-gnu/libmjpegutils-2.1.so.0.0.0 28113
-usr/lib/i386-linux-gnu/libmpeg2encpp-2.1.so.0.0.0 28112
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegpsdemux.so 28111
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegpsmux.so 28110
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegtsdemux.so 28109
-usr/lib/i386-linux-gnu/libgstcodecparsers-1.0.so.0.404.0 28108
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegtsmux.so 28107
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpg123.so 28106
-usr/lib/i386-linux-gnu/libmpg123.so.0.40.3 28105
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmplex.so 28104
-usr/lib/i386-linux-gnu/libmplex2-2.1.so.0.0.0 28103
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmulaw.so 28102
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmultifile.so 28101
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmultipart.so 28100
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmxf.so 28099
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstnavigationtest.so 28098
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstofa.so 28097
-usr/lib/libofa.so.0.0.0 28096
-usr/lib/i386-linux-gnu/libfftw3.so.3.4.4 28095
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstogg.so 28094
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenal.so 28093
-usr/lib/i386-linux-gnu/libopenal.so.1.15.1 28092
-usr/share/icons/hicolor/64x64/apps/icedove.png 28091
-usr/share/icons/hicolor/scalable/apps/pidgin.svg 28090
-usr/share/icons/hicolor/64x64/apps/keepassx.png 28089
-usr/share/icons/Adwaita/256x256/apps/utilities-terminal.png 28088
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopencv.so 28087
-usr/lib/i386-linux-gnu/libopencv_calib3d.so.2.4.9 28086
-usr/lib/i386-linux-gnu/libopencv_contrib.so.2.4.9 28085
-usr/lib/i386-linux-gnu/libopencv_core.so.2.4.9 28084
-usr/share/icons/hicolor/scalable/status/tor-connected-symbolic.svg 28083
-usr/lib/i386-linux-gnu/libopencv_highgui.so.2.4.9 28082
-usr/lib/i386-linux-gnu/libopencv_imgproc.so.2.4.9 28081
-usr/lib/i386-linux-gnu/libopencv_legacy.so.2.4.9 28080
-usr/share/icons/Adwaita/scalable/status/dialog-information-symbolic.svg 28079
-usr/lib/i386-linux-gnu/libopencv_objdetect.so.2.4.9 28078
-usr/lib/i386-linux-gnu/libopencv_video.so.2.4.9 28077
-usr/lib/i386-linux-gnu/libopencv_flann.so.2.4.9 28076
-usr/lib/i386-linux-gnu/libopencv_features2d.so.2.4.9 28075
-usr/lib/i386-linux-gnu/libGLU.so.1.3.1 28074
-usr/lib/libtbb.so.2 28073
-usr/lib/i386-linux-gnu/libopencv_ml.so.2.4.9 28072
-usr/share/icons/Adwaita/scalable/devices/network-wired-symbolic.svg 28071
-usr/share/icons/gnome/48x48/status/dialog-information.png 28070
-usr/share/gnome-shell/theme/message-tray-background.png 28069
-usr/share/gnome-shell/theme/summary-counter.svg 28068
-usr/lib/i386-linux-gnu/libjasper.so.1.0.0 28067
-usr/lib/i386-linux-gnu/libImath.so.6.0.0 28066
-usr/lib/i386-linux-gnu/libIlmImf.so.6.0.0 28065
-usr/share/perl5/auto/share/dist/OpenPGP_Applet/pixmaps/22x22/OpenPGP_Applet-text.png 28064
-usr/lib/i386-linux-gnu/libIex.so.6.0.0 28063
-usr/lib/i386-linux-gnu/libHalf.so.6.0.0 28062
-usr/lib/i386-linux-gnu/libIlmThread.so.6.0.0 28061
-usr/lib/libgtkglext-x11-1.0.so.0.0.0 28060
-usr/lib/libgdkglext-x11-1.0.so.0.0.0 28059
-usr/lib/i386-linux-gnu/libXmu.so.6.2.0 28058
-usr/lib/i386-linux-gnu/libXt.so.6.0.0 28057
-usr/lib/i386-linux-gnu/libpangox-1.0.so.0.0.0 28056
-usr/lib/i386-linux-gnu/libdc1394.so.22.1.10 28055
-usr/lib/i386-linux-gnu/i686/cmov/libswscale.so.3.0.0 28054
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenexr.so 28053
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopengl.so 28052
-usr/lib/i386-linux-gnu/libgstgl-1.0.so.0.404.0 28051
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenjpeg.so 28050
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopus.so 28049
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstoss4audio.so 28048
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstossaudio.so 28047
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpango.so 28046
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpcapparse.so 28045
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstplayback.so 28044
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpng.so 28043
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpnm.so 28042
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrawparse.so 28041
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstremovesilence.so 28040
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstreplaygain.so 28039
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstresindvd.so 28038
-usr/lib/i386-linux-gnu/libdvdnav.so.4.1.2 28037
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrfbsrc.so 28036
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrmdemux.so 28035
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrsvg.so 28034
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtmp.so 28033
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtp.so 28032
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtpmanager.so 28031
-usr/lib/i386-linux-gnu/libgstnet-1.0.so.0.404.0 28030
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtsp.so 28029
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsbc.so 28028
-usr/lib/i386-linux-gnu/libsbc.so.1.2.0 28027
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstschro.so 28026
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsdpelem.so 28025
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsegmentclip.so 28024
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshapewipe.so 28023
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshm.so 28022
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshout2.so 28021
-usr/lib/i386-linux-gnu/libshout.so.3.2.0 28020
-usr/lib/i386-linux-gnu/libtheora.so.0.3.10 28019
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsid.so 28018
-usr/lib/libsidplay.so.1.0.3 28017
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsiren.so 28016
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmooth.so 28015
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmoothstreaming.so 28014
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmpte.so 28013
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsndfile.so 28012
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsoundtouch.so 28011
-usr/lib/i386-linux-gnu/libSoundTouch.so.0.0.0 28010
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsouphttpsrc.so 28009
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspandsp.so 28008
-usr/lib/i386-linux-gnu/libspandsp.so.2.0.0 28007
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspectrum.so 28006
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspeed.so 28005
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspeex.so 28004
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsrtp.so 28003
-usr/lib/libsrtp.so.0.0 28002
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgststereo.so 28001
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsubenc.so 28000
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsubparse.so 27999
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttaglib.so 27998
-usr/lib/i386-linux-gnu/libtag.so.1.14.0 27997
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttcp.so 27996
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttheora.so 27995
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttwolame.so 27994
-usr/lib/libtwolame.so.0.0.0 27993
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttypefindfunctions.so 27992
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstudp.so 27991
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstuvch264.so 27990
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideo4linux2.so 27989
-usr/lib/i386-linux-gnu/libgstallocators-1.0.so.0.404.0 27988
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideobox.so 27987
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoconvert.so 27986
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideocrop.so 27985
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideofilter.so 27984
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideofiltersbad.so 27983
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideomixer.so 27982
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoparsersbad.so 27981
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideorate.so 27980
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoscale.so 27979
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideosignal.so 27978
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideotestsrc.so 27977
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvmnc.so 27976
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvoaacenc.so 27975
-usr/lib/i386-linux-gnu/libvo-aacenc.so.0.0.4 27974
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvoamrwbenc.so 27973
-usr/lib/i386-linux-gnu/libvo-amrwbenc.so.0.0.4 27972
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvolume.so 27971
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvorbis.so 27970
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvpx.so 27969
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavenc.so 27968
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavpack.so 27967
-usr/lib/i386-linux-gnu/libwavpack.so.1.1.5 27966
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavparse.so 27965
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwaylandsink.so 27964
-usr/lib/i386-linux-gnu/libgstwayland-1.0.so.0.404.0 27963
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwebp.so 27962
-usr/lib/i386-linux-gnu/libwebp.so.5.0.1 27961
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwildmidi.so 27960
-usr/lib/i386-linux-gnu/libWildMidi.so.1.1.2 27959
-etc/wildmidi/wildmidi.cfg 27958
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstx264.so 27957
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstximagesink.so 27956
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstximagesrc.so 27955
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstxingmux.so 27954
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstxvimagesink.so 27953
-usr/lib/i386-linux-gnu/libXv.so.1.0.0 27952
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsty4mdec.so 27951
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgsty4menc.so 27950
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstyadif.so 27949
-usr/lib/i386-linux-gnu/gstreamer-1.0/libgstzbar.so 27948
-usr/lib/libzbar.so.0.2.0 27947
-usr/share/florence/layouts/florence.xml 27946
-usr/share/florence/relaxng/florence.rng 27945
-usr/share/florence/styles/hard/florence.style 27944
-usr/share/florence/styles/hard/default.svg 27943
-usr/share/florence/styles/hard/tiny.svg 27942
-usr/share/florence/styles/hard/mini.svg 27941
-usr/share/florence/styles/hard/small.svg 27940
-usr/share/florence/styles/hard/wide.svg 27939
-usr/share/florence/styles/hard/xl.svg 27938
-usr/share/florence/styles/hard/xxl.svg 27937
-usr/share/florence/styles/hard/high.svg 27936
-usr/share/florence/styles/hard/space.svg 27935
-usr/share/florence/styles/hard/return.svg 27934
-usr/share/florence/styles/default/symbols.xml 27933
-usr/share/pixmaps/florence.svg 27932
-usr/share/florence/styles/default/sounds/sounds.xml 27931
-usr/share/florence/relaxng/style.rng 27930
-usr/share/florence/relaxng/svg11.rng 27929
-usr/share/florence/relaxng/svg-container-attrib.rng 27928
-usr/share/florence/relaxng/svg-viewport-attrib.rng 27927
-usr/share/florence/relaxng/svg-paint-attrib.rng 27926
-usr/share/florence/relaxng/svg-opacity-attrib.rng 27925
-usr/share/florence/relaxng/svg-graphics-attrib.rng 27924
-usr/share/florence/relaxng/svg-basic-graphics-attrib.rng 27923
-usr/share/florence/relaxng/svg-docevents-attrib.rng 27922
-usr/share/florence/relaxng/svg-graphevents-attrib.rng 27921
-usr/share/florence/relaxng/svg-animevents-attrib.rng 27920
-usr/share/florence/relaxng/svg-xlink-attrib.rng 27919
-usr/share/florence/relaxng/svg-extresources-attrib.rng 27918
-usr/share/florence/relaxng/svg-structure.rng 27917
-usr/share/florence/relaxng/svg-basic-structure.rng 27916
-usr/share/florence/relaxng/svg-datatypes.rng 27915
-usr/share/florence/relaxng/svg-core-attrib.rng 27914
-usr/share/florence/relaxng/svg-conditional.rng 27913
-usr/share/florence/relaxng/svg-image.rng 27912
-usr/share/florence/relaxng/svg-style.rng 27911
-usr/share/florence/relaxng/svg-shape.rng 27910
-usr/share/florence/relaxng/svg-text.rng 27909
-usr/share/florence/relaxng/svg-basic-text.rng 27908
-usr/share/florence/relaxng/svg-marker.rng 27907
-usr/share/florence/relaxng/svg-profile.rng 27906
-usr/share/florence/relaxng/svg-gradient.rng 27905
-usr/share/florence/relaxng/svg-pattern.rng 27904
-usr/share/florence/relaxng/svg-clip.rng 27903
-usr/share/florence/relaxng/svg-basic-clip.rng 27902
-usr/share/florence/relaxng/svg-mask.rng 27901
-usr/share/florence/relaxng/svg-filter.rng 27900
-usr/share/florence/relaxng/svg-basic-filter.rng 27899
-usr/share/florence/relaxng/svg-cursor.rng 27898
-usr/share/florence/relaxng/svg-hyperlink.rng 27897
-usr/share/florence/relaxng/svg-view.rng 27896
-usr/share/florence/relaxng/svg-script.rng 27895
-usr/share/florence/relaxng/svg-animation.rng 27894
-usr/share/florence/relaxng/svg-font.rng 27893
-usr/share/florence/relaxng/svg-basic-font.rng 27892
-usr/share/florence/relaxng/svg-extensibility.rng 27891
-usr/share/florence/florence.css 27890
-usr/share/florence/styles/hard/florence.defs 27889
-usr/share/icons/Adwaita/scalable/places/user-home-symbolic.svg 27888
-usr/share/icons/Adwaita/scalable/places/folder-documents-symbolic.svg 27887
-usr/share/icons/Adwaita/scalable/places/folder-download-symbolic.svg 27886
-usr/share/icons/Adwaita/scalable/places/folder-music-symbolic.svg 27885
-usr/share/icons/Adwaita/scalable/places/folder-pictures-symbolic.svg 27884
-usr/share/icons/Adwaita/scalable/places/folder-videos-symbolic.svg 27883
-usr/share/icons/Adwaita/scalable/devices/drive-harddisk-symbolic.svg 27882
-usr/share/icons/Adwaita/scalable/places/folder-symbolic.svg 27881
-usr/share/icons/Adwaita/scalable/places/network-workgroup-symbolic.svg 27880
-usr/local/bin/tor-browser 27879
-usr/local/lib/tails-shell-library/tor-browser.sh 27878
-usr/local/lib/tor-browser/firefox 27877
-usr/local/lib/tor-browser/libstdc++.so.6 27876
-usr/local/lib/tor-browser/dependentlibs.list 27875
-usr/local/lib/tor-browser/libnspr4.so 27874
-usr/local/lib/tor-browser/libplc4.so 27873
-usr/local/lib/tor-browser/libplds4.so 27872
-usr/local/lib/tor-browser/libnssutil3.so 27871
-usr/local/lib/tor-browser/libnss3.so 27870
-usr/local/lib/tor-browser/libsmime3.so 27869
-usr/local/lib/tor-browser/libssl3.so 27868
-usr/local/lib/tor-browser/libmozsqlite3.so 27867
-usr/local/lib/tor-browser/liblgpllibs.so 27866
-usr/local/lib/tor-browser/libxul.so 27865
-bin/df 27864
-usr/bin/tails-upgrade-frontend 27863
-usr/share/perl/5.20.2/FindBin.pm 27862
-usr/lib/i386-linux-gnu/perl/5.20.2/lib.pm 27861
-usr/share/perl5/Tails/IUK/Frontend.pm 27860
-usr/share/perl5/MooseX/Types/Path/Class.pm 27859
-usr/share/perl5/Path/Class.pm 27858
-usr/share/perl5/Path/Class/File.pm 27857
-usr/share/perl5/Path/Class/Dir.pm 27856
-usr/share/perl5/Path/Class/Entity.pm 27855
-usr/share/perl/5.20.2/File/stat.pm 27854
-usr/lib/i386-linux-gnu/perl/5.20.2/IO/Dir.pm 27853
-usr/share/perl/5.20.2/Perl/OSType.pm 27852
-usr/share/perl/5.20.2/File/Copy.pm 27851
-usr/share/perl5/MooseX/Getopt.pm 27850
-usr/share/perl5/MooseX/Getopt/GLD.pm 27849
-usr/share/perl5/MooseX/Role/Parameterized.pm 27848
-usr/share/perl5/MooseX/Role/Parameterized/Meta/Trait/Parameterizable.pm 27847
-usr/share/perl5/MooseX/Role/Parameterized/Meta/Role/Parameterized.pm 27846
-usr/share/perl5/MooseX/Role/Parameterized/Meta/Trait/Parameterized.pm 27845
-usr/share/perl5/MooseX/Role/Parameterized/Parameters.pm 27844
-usr/share/perl5/MooseX/Getopt/Basic.pm 27843
-usr/share/perl5/MooseX/Getopt/OptionTypeMap.pm 27842
-usr/share/perl5/MooseX/Getopt/Meta/Attribute.pm 27841
-usr/share/perl5/MooseX/Getopt/Meta/Attribute/Trait.pm 27840
-usr/share/perl5/MooseX/Getopt/Meta/Attribute/NoGetopt.pm 27839
-usr/share/perl5/MooseX/Getopt/Meta/Attribute/Trait/NoGetopt.pm 27838
-usr/share/perl5/MooseX/Getopt/ProcessedArgv.pm 27837
-usr/share/perl/5.20.2/Env.pm 27836
-usr/share/perl/5.20.2/Tie/Array.pm 27835
-usr/share/perl5/IPC/Run.pm 27834
-usr/share/perl5/IPC/Run/Debug.pm 27833
-usr/share/perl5/IPC/Run/IO.pm 27832
-usr/share/perl5/IPC/Run/Timer.pm 27831
-usr/share/perl5/IPC/Run/SafeHandles.pm 27830
-usr/share/perl5/Number/Format.pm 27829
-usr/share/perl5/String/Errf.pm 27828
-usr/share/perl5/String/Formatter.pm 27827
-usr/lib/i386-linux-gnu/perl/5.20.2/Time/Piece.pm 27826
-usr/lib/i386-linux-gnu/perl/5.20.2/Time/Seconds.pm 27825
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Time/Piece/Piece.so 27824
-usr/share/perl5/Tails/RunningSystem.pm 27823
-usr/share/perl5/Sys/Statistics/Linux/MemStats.pm 27822
-usr/share/perl5/Tails/Constants.pm 27821
-usr/share/perl5/Method/Signatures/Simple.pm 27820
-usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare/MethodInstaller/Simple.pm 27819
-usr/share/perl5/Tails/UDisks.pm 27818
-usr/share/perl5/Syntax/Keyword/Junction.pm 27817
-usr/share/perl5/Syntax/Keyword/Junction/All.pm 27816
-usr/share/perl5/Syntax/Keyword/Junction/Base.pm 27815
-usr/share/perl5/Syntax/Keyword/Junction/Any.pm 27814
-usr/share/perl5/Syntax/Keyword/Junction/None.pm 27813
-usr/share/perl5/Syntax/Keyword/Junction/One.pm 27812
-usr/lib/i386-linux-gnu/perl5/5.20/Unix/Mknod.pm 27811
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Unix/Mknod/Mknod.so 27810
-usr/share/perl5/Tails/Role/HasDBus/System.pm 27809
-usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/GLib.pm 27808
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Net/DBus/GLib/GLib.so 27807
-usr/share/perl5/Tails/Role/HasEncoding.pm 27806
-usr/share/perl5/Tails/Role/HasCodeset.pm 27805
-usr/share/perl5/Tails/Role/DisplayError/Gtk3.pm 27804
-usr/share/perl5/Tails/IUK/UpgradeDescriptionFile.pm 27803
-usr/share/perl5/Dpkg/Version.pm 27802
-usr/share/perl5/Dpkg/ErrorHandling.pm 27801
-usr/share/perl5/Dpkg.pm 27800
-usr/share/perl5/Dpkg/Gettext.pm 27799
-usr/share/perl5/YAML/Any.pm 27798
-usr/lib/i386-linux-gnu/perl5/5.20/YAML/XS.pm 27797
-usr/lib/i386-linux-gnu/perl5/5.20/YAML/XS/LibYAML.pm 27796
-usr/lib/i386-linux-gnu/perl5/5.20/auto/YAML/XS/LibYAML/LibYAML.so 27795
-usr/share/perl/5.20.2/B/Deparse.pm 27794
-usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/clear.pm 27793
-usr/share/perl5/Tails/IUK/Utils.pm 27792
-usr/share/perl/5.20.2/Archive/Tar.pm 27791
-usr/share/perl/5.20.2/IO/Zlib.pm 27790
-usr/share/perl/5.20.2/Compress/Zlib.pm 27789
-usr/share/perl/5.20.2/IO/Compress/Base/Common.pm 27788
-usr/share/perl/5.20.2/File/GlobMapper.pm 27787
-usr/lib/i386-linux-gnu/perl/5.20.2/Compress/Raw/Zlib.pm 27786
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Compress/Raw/Zlib/Zlib.so 27785
-usr/share/perl/5.20.2/IO/Compress/Gzip.pm 27784
-usr/share/perl/5.20.2/IO/Compress/RawDeflate.pm 27783
-usr/share/perl/5.20.2/IO/Compress/Base.pm 27782
-usr/share/perl/5.20.2/IO/Compress/Adapter/Deflate.pm 27781
-usr/share/perl/5.20.2/IO/Compress/Gzip/Constants.pm 27780
-usr/share/perl/5.20.2/IO/Compress/Zlib/Extra.pm 27779
-usr/share/perl/5.20.2/IO/Uncompress/Gunzip.pm 27778
-usr/share/perl/5.20.2/IO/Uncompress/RawInflate.pm 27777
-usr/share/perl/5.20.2/IO/Uncompress/Base.pm 27776
-usr/share/perl/5.20.2/IO/Uncompress/Adapter/Inflate.pm 27775
-usr/share/perl/5.20.2/Tie/Handle.pm 27774
-usr/share/perl/5.20.2/Tie/StdHandle.pm 27773
-usr/share/perl/5.20.2/Archive/Tar/File.pm 27772
-usr/share/perl/5.20.2/Archive/Tar/Constant.pm 27771
-usr/share/perl/5.20.2/IO/Uncompress/Bunzip2.pm 27770
-usr/share/perl/5.20.2/IO/Uncompress/Adapter/Bunzip2.pm 27769
-usr/lib/i386-linux-gnu/perl/5.20.2/Compress/Raw/Bzip2.pm 27768
-usr/lib/i386-linux-gnu/perl/5.20.2/auto/Compress/Raw/Bzip2/Bzip2.so 27767
-usr/share/perl/5.20.2/IO/Compress/Bzip2.pm 27766
-usr/share/perl/5.20.2/IO/Compress/Adapter/Bzip2.pm 27765
-usr/share/perl5/Moo/HandleMoose.pm 27764
-usr/share/perl5/Moo/HandleMoose/FakeMetaClass.pm 27763
-usr/lib/i386-linux-gnu/perl5/5.20/Filesys/Df.pm 27762
-usr/lib/i386-linux-gnu/perl5/5.20/auto/Filesys/Df/Df.so 27761
-usr/share/perl5/Tails/MirrorPool.pm 27760
-usr/share/perl5/Tails/IUK/Role/HasEncoding.pm 27759
-usr/share/perl5/Tails/IUK/Role/HasCodeset.pm 27758
-usr/share/perl5/MooseX/Getopt/Dashes.pm 27757
-usr/bin/tails-iuk-get-upgrade-description-file 27756
-usr/share/perl5/Tails/IUK/UpgradeDescriptionFile/Download.pm 27755
-usr/lib/i386-linux-gnu/gconv/UTF-16.so 27754
-usr/local/lib/tor-browser/TorBrowser/Data/Browser/profiles.ini 27753
-usr/local/lib/tor-browser/omni.ja 27752
-usr/local/lib/tor-browser/browser/omni.ja 27751
-usr/local/lib/tor-browser/defaults/pref/channel-prefs.js 27750
-usr/local/lib/tor-browser/browser/chrome.manifest 27749
-usr/local/lib/tor-browser/browser/components/components.manifest 27748
-usr/local/lib/tor-browser/browser/components/libbrowsercomps.so 27747
-usr/local/lib/tor-browser/TorBrowser/Data/fontconfig/fonts.conf 27746
-usr/local/lib/tor-browser/fonts/Arimo-Bold.ttf 27745
-usr/local/lib/tor-browser/fonts/Arimo-BoldItalic.ttf 27744
-usr/local/lib/tor-browser/fonts/Arimo-Italic.ttf 27743
-usr/local/lib/tor-browser/fonts/Arimo-Regular.ttf 27742
-usr/local/lib/tor-browser/fonts/Cousine-Regular.ttf 27741
-usr/local/lib/tor-browser/fonts/NotoEmoji-Regular.ttf 27740
-usr/local/lib/tor-browser/fonts/NotoNaskhArabic-Regular.ttf 27739
-usr/local/lib/tor-browser/fonts/NotoSansArmenian-Regular.ttf 27738
-usr/local/lib/tor-browser/fonts/NotoSansBengali-Regular.ttf 27737
-usr/local/lib/tor-browser/fonts/NotoSansBuginese-Regular.ttf 27736
-usr/local/lib/tor-browser/fonts/NotoSansCanadianAboriginal-Regular.ttf 27735
-usr/local/lib/tor-browser/fonts/NotoSansCherokee-Regular.ttf 27734
-usr/local/lib/tor-browser/fonts/NotoSansDevanagari-Regular.ttf 27733
-usr/local/lib/tor-browser/fonts/NotoSansEthiopic-Regular.ttf 27732
-usr/local/lib/tor-browser/fonts/NotoSansGeorgian-Regular.ttf 27731
-usr/local/lib/tor-browser/fonts/NotoSansGujarati-Regular.ttf 27730
-usr/local/lib/tor-browser/fonts/NotoSansGurmukhi-Regular.ttf 27729
-usr/local/lib/tor-browser/fonts/NotoSansHebrew-Regular.ttf 27728
-usr/local/lib/tor-browser/fonts/NotoSansJP-Regular.otf 27727
-usr/local/lib/tor-browser/fonts/NotoSansKR-Regular.otf 27726
-usr/local/lib/tor-browser/fonts/NotoSansKannada-Regular.ttf 27725
-usr/local/lib/tor-browser/fonts/NotoSansKhmer-Regular.ttf 27724
-usr/local/lib/tor-browser/fonts/NotoSansLao-Regular.ttf 27723
-usr/local/lib/tor-browser/fonts/NotoSansMalayalam-Regular.ttf 27722
-usr/local/lib/tor-browser/fonts/NotoSansMongolian-Regular.ttf 27721
-usr/local/lib/tor-browser/fonts/NotoSansMyanmar-Regular.ttf 27720
-usr/local/lib/tor-browser/fonts/NotoSansOriya-Regular.ttf 27719
-usr/local/lib/tor-browser/fonts/NotoSansSC-Regular.otf 27718
-usr/local/lib/tor-browser/fonts/NotoSansSinhala-Regular.ttf 27717
-usr/local/lib/tor-browser/fonts/NotoSansTC-Regular.otf 27716
-usr/local/lib/tor-browser/fonts/NotoSansTamil-Regular.ttf 27715
-usr/local/lib/tor-browser/fonts/NotoSansTelugu-Regular.ttf 27714
-usr/local/lib/tor-browser/fonts/NotoSansThaana-Regular.ttf 27713
-usr/local/lib/tor-browser/fonts/NotoSansThai-Regular.ttf 27712
-usr/local/lib/tor-browser/fonts/NotoSansTibetan-Regular.ttf 27711
-usr/local/lib/tor-browser/fonts/NotoSansYi-Regular.ttf 27710
-usr/local/lib/tor-browser/fonts/NotoSerifArmenian-Regular.ttf 27709
-usr/local/lib/tor-browser/fonts/NotoSerifKhmer-Regular.ttf 27708
-usr/local/lib/tor-browser/fonts/NotoSerifLao-Regular.ttf 27707
-usr/local/lib/tor-browser/fonts/NotoSerifThai-Regular.ttf 27706
-usr/local/lib/tor-browser/fonts/STIXMath-Regular.otf 27705
-usr/local/lib/tor-browser/fonts/Tinos-Bold.ttf 27704
-usr/local/lib/tor-browser/fonts/Tinos-BoldItalic.ttf 27703
-usr/local/lib/tor-browser/fonts/Tinos-Italic.ttf 27702
-usr/local/lib/tor-browser/fonts/Tinos-Regular.ttf 27701
-usr/share/icons/Adwaita/cursors/xterm 27700
-usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/immodules.cache 27699
-usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/immodules/im-ibus.so 27698
-usr/local/lib/tor-browser/browser/blocklist.xml 27697
-usr/local/lib/tor-browser/libsoftokn3.so 27696
-usr/local/lib/tor-browser/libfreebl3.so 27695
-usr/local/lib/tor-browser/libnssckbi.so 27694
-usr/share/xul-ext/adblock-plus/install.rdf 27693
-usr/share/xul-ext/adblock-plus/chrome.manifest 27692
-usr/local/share/tor-browser-extensions/{73a6fe31-595d-460b-a920-fcc0f8843232}.xpi 27691
-usr/local/share/tor-browser-extensions/torbutton@torproject.org.xpi 27690
-usr/local/share/tor-browser-extensions/langpack-zh-CN@firefox.mozilla.org.xpi 27689
-usr/local/share/tor-browser-extensions/langpack-vi@firefox.mozilla.org.xpi 27688
-usr/local/share/tor-browser-extensions/langpack-tr@firefox.mozilla.org.xpi 27687
-usr/local/share/tor-browser-extensions/langpack-ru@firefox.mozilla.org.xpi 27686
-usr/local/share/tor-browser-extensions/langpack-pt-PT@firefox.mozilla.org.xpi 27685
-usr/local/share/tor-browser-extensions/langpack-pl@firefox.mozilla.org.xpi 27684
-usr/local/share/tor-browser-extensions/langpack-nl@firefox.mozilla.org.xpi 27683
-usr/local/share/tor-browser-extensions/langpack-ko@firefox.mozilla.org.xpi 27682
-usr/local/share/tor-browser-extensions/langpack-ja@firefox.mozilla.org.xpi 27681
-usr/local/share/tor-browser-extensions/langpack-it@firefox.mozilla.org.xpi 27680
-usr/local/share/tor-browser-extensions/langpack-fr@firefox.mozilla.org.xpi 27679
-usr/local/share/tor-browser-extensions/langpack-fa@firefox.mozilla.org.xpi 27678
-usr/local/share/tor-browser-extensions/langpack-es-ES@firefox.mozilla.org.xpi 27677
-usr/local/share/tor-browser-extensions/langpack-de@firefox.mozilla.org.xpi 27676
-usr/local/share/tor-browser-extensions/langpack-ar@firefox.mozilla.org.xpi 27675
-usr/local/share/tor-browser-extensions/https-everywhere-eff@eff.org.xpi 27674
-usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/install.rdf 27673
-usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/chrome.manifest 27672
-usr/local/lib/tor-browser/browser/extensions/{972ce4c6-7e08-4474-a285-3208198ce6fd}.xpi 27671
-usr/share/xul-ext/adblock-plus/bootstrap.js 27670
-usr/share/xul-ext/adblock-plus/lib/main.js 27669
-usr/share/xul-ext/adblock-plus/lib/child/bootstrap.js 27668
-usr/share/mime/application/javascript.xml 27667
-usr/share/xul-ext/adblock-plus/lib/child/main.js 27666
-usr/share/xul-ext/adblock-plus/lib/messaging.js 27665
-usr/share/xul-ext/adblock-plus/lib/filterListener.js 27664
-usr/share/xul-ext/adblock-plus/lib/filterStorage.js 27663
-usr/share/xul-ext/adblock-plus/lib/io.js 27662
-usr/share/xul-ext/adblock-plus/lib/prefs.js 27661
-usr/share/xul-ext/adblock-plus/lib/utils.js 27660
-usr/share/xul-ext/adblock-plus/lib/filterClasses.js 27659
-usr/share/xul-ext/adblock-plus/lib/filterNotifier.js 27658
-usr/share/xul-ext/adblock-plus/lib/events.js 27657
-usr/share/xul-ext/adblock-plus/lib/subscriptionClasses.js 27656
-usr/share/xul-ext/adblock-plus/lib/elemHide.js 27655
-usr/share/xul-ext/adblock-plus/lib/cssRules.js 27654
-usr/share/xul-ext/adblock-plus/lib/matcher.js 27653
-usr/share/xul-ext/adblock-plus/lib/contentPolicy.js 27652
-usr/share/xul-ext/adblock-plus/lib/synchronizer.js 27651
-usr/share/xul-ext/adblock-plus/lib/downloader.js 27650
-usr/share/xul-ext/adblock-plus/lib/notification.js 27649
-usr/share/xul-ext/adblock-plus/lib/sync.js 27648
-usr/share/xul-ext/adblock-plus/lib/messageResponder.js 27647
-usr/share/xul-ext/adblock-plus/lib/ext_background.js 27646
-usr/share/xul-ext/adblock-plus/lib/ext_common.js 27645
-usr/share/xul-ext/adblock-plus/lib/ui.js 27644
-usr/share/xul-ext/adblock-plus/lib/requestNotifier.js 27643
-usr/share/xul-ext/adblock-plus/lib/keySelector.js 27642
-usr/share/xul-ext/adblock-plus/lib/antiadblockInit.js 27641
-usr/share/xul-ext/adblock-plus/chrome/content/ui/overlay.xul 27640
-usr/share/xul-ext/adblock-plus/lib/appSupport.js 27639
-usr/share/xul-ext/adblock-plus/lib/objectTabs.js 27638
-usr/share/xul-ext/adblock-plus/chrome/content/objtabs.css 27637
-usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/defaults/preferences/prefs.js 27636
-usr/lib/locale/C.UTF-8/LC_IDENTIFICATION 27635
-usr/lib/locale/C.UTF-8/LC_MEASUREMENT 27634
-usr/lib/locale/C.UTF-8/LC_TELEPHONE 27633
-usr/lib/locale/C.UTF-8/LC_ADDRESS 27632
-usr/lib/locale/C.UTF-8/LC_NAME 27631
-usr/lib/locale/C.UTF-8/LC_PAPER 27630
-usr/lib/locale/C.UTF-8/LC_MESSAGES/SYS_LC_MESSAGES 27629
-usr/lib/locale/C.UTF-8/LC_MONETARY 27628
-usr/lib/locale/C.UTF-8/LC_COLLATE 27627
-usr/lib/locale/C.UTF-8/LC_TIME 27626
-usr/lib/locale/C.UTF-8/LC_NUMERIC 27625
-usr/local/lib/tor-browser/browser/chrome/icons/default/default16.png 27624
-usr/local/lib/tor-browser/browser/chrome/icons/default/default32.png 27623
-usr/local/lib/tor-browser/browser/chrome/icons/default/default48.png 27622
-usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/chrome/locale/en-US/amnesia.properties 27621
-usr/share/xul-ext/adblock-plus/chrome/locale/en-US/overlay.dtd 27620
-usr/share/xul-ext/adblock-plus/chrome/locale/en-US/subscriptionSelection.dtd 27619
-usr/share/xul-ext/adblock-plus/lib/windowObserver.js 27618
-usr/share/xul-ext/adblock-plus/lib/child/elemHide.js 27617
-usr/share/xul-ext/adblock-plus/lib/child/contentPolicy.js 27616
-usr/share/xul-ext/adblock-plus/lib/child/utils.js 27615
-usr/share/xul-ext/adblock-plus/lib/child/objectTabs.js 27614
-usr/share/xul-ext/adblock-plus/lib/child/requestNotifier.js 27613
-usr/share/xul-ext/adblock-plus/lib/child/flasher.js 27612
-usr/share/xul-ext/adblock-plus/lib/child/contextMenu.js 27611
-usr/share/xul-ext/adblock-plus/lib/child/dataCollector.js 27610
-usr/share/xul-ext/adblock-plus/lib/child/cssProperties.js 27609
-usr/share/xul-ext/adblock-plus/chrome/content/cssProperties.js 27608
-usr/share/xul-ext/adblock-plus/lib/child/subscribeLinks.js 27607
-usr/lib/i386-linux-gnu/libXss.so.1.0.0 27606
-usr/share/mime/application/xml.xml 27605
-usr/share/icons/Adwaita/16x16/actions/list-add.png 27604
-usr/share/xul-ext/adblock-plus/lib/whitelisting.js 27603
-usr/share/xul-ext/adblock-plus/chrome/skin/overlay.css 27602
-usr/share/themes/Adwaita/gtk-2.0/Arrows/arrow-down.png 27601
-usr/share/xul-ext/adblock-plus/chrome/skin/close.png 27600
-etc/mime.types 27599
-usr/share/mime/application/pdf.xml 27598
-usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/ddg-en-US.xml 27597
-usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/startpage-en-US.xml 27596
-usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/wikipedia-en-US.xml 27595
-usr/share/themes/Adwaita/gtk-2.0/Buttons/button-default.png 27594
-usr/share/xul-ext/adblock-plus/chrome/locale/en-US/global.properties 27593
-usr/share/themes/Adwaita/gtk-2.0/Scrollbars/trough-scrollbar-vert.png 27592
-usr/share/themes/Adwaita/gtk-2.0/Scrollbars/slider-vert.png 27591
+lib/i386-linux-gnu/libdevmapper-event.so.1.02.1 31502
+lib/i386-linux-gnu/libdevmapper.so.1.02.1 31501
+lib/i386-linux-gnu/libreadline.so.5.2 31500
+usr/lib/i386-linux-gnu/libasound.so.2.0.0 31499
+usr/share/alsa/alsa.conf 31497
+usr/share/alsa/alsa.conf.d/50-pulseaudio.conf 31496
+usr/share/alsa/alsa.conf.d/pulse.conf 31495
+etc/asound.conf 31494
+usr/lib/i386-linux-gnu/alsa-lib/libasound_module_conf_pulse.so 31493
+usr/lib/i386-linux-gnu/libpulse.so.0.17.3 31492
+lib/i386-linux-gnu/libjson-c.so.2.0.0 31491
+usr/lib/i386-linux-gnu/pulseaudio/libpulsecommon-5.0.so 31490
+etc/lvm/lvm.conf 31489
+usr/lib/i386-linux-gnu/libX11-xcb.so.1.0.0 31488
+usr/lib/i386-linux-gnu/libICE.so.6.3.0 31487
+usr/lib/i386-linux-gnu/libSM.so.6.0.1 31486
+usr/lib/i386-linux-gnu/libXtst.so.6.1.0 31485
+lib/i386-linux-gnu/libwrap.so.0.7.6 31484
+usr/lib/i386-linux-gnu/libsndfile.so.1.0.25 31483
+usr/lib/i386-linux-gnu/libasyncns.so.0.3.1 31482
+usr/lib/i386-linux-gnu/libXext.so.6.4.0 31481
+usr/lib/i386-linux-gnu/libXi.so.6.1.0 31480
+usr/lib/i386-linux-gnu/libFLAC.so.8.3.0 31479
+usr/lib/i386-linux-gnu/libvorbisenc.so.2.0.10 31478
+usr/lib/i386-linux-gnu/libogg.so.0.8.2 31477
+usr/lib/i386-linux-gnu/libvorbis.so.0.4.7 31476
+etc/pulse/client.conf 31475
+etc/machine-id 31474
+usr/share/alsa/init/00main 31473
+usr/share/alsa/init/hda 31472
+usr/share/alsa/init/default 31471
+etc/init.d/alsa-utils 31470
+etc/init.d/kbd 31469
+etc/kbd/config 31468
+bin/systemd-tmpfiles 31467
+usr/lib/tmpfiles.d/debian.conf 31466
+usr/lib/tmpfiles.d/gvfsd-fuse-tmpfiles.conf 31465
+run/tmpfiles.d/kmod.conf 31464
+usr/lib/tmpfiles.d/laptop-mode.conf 31463
+usr/lib/tmpfiles.d/legacy.conf 31462
+usr/lib/tmpfiles.d/lvm2.conf 31461
+usr/lib/tmpfiles.d/man-db.conf 31460
+usr/lib/tmpfiles.d/systemd-nologin.conf 31459
+usr/lib/tmpfiles.d/systemd.conf 31458
+usr/lib/tmpfiles.d/tmp.conf 31457
+usr/lib/tmpfiles.d/tor-has-bootstrapped.conf 31456
+usr/lib/tmpfiles.d/var.conf 31455
+usr/lib/tmpfiles.d/x11.conf 31454
+etc/init.d/live-tools 31451
+var/log/wtmp 31450
+var/log/btmp 31449
+bin/systemctl 31448
+etc/init.d/networking 31446
+lib/systemd/systemd-update-utmp 31445
+etc/default/networking 31444
+usr/share/alsa/utils.sh 31443
+sbin/ifup 31440
+lib/live/mount/overlay/etc/network/interfaces 31439
+etc/macchanger/ifupdown.sh 31438
+etc/default/macchanger 31437
+etc/network/if-pre-up.d/wireless-tools 31435
+etc/wpa_supplicant/ifupdown.sh 31434
+etc/wpa_supplicant/functions.sh 31433
+etc/network/if-up.d/mountnfs 31432
+etc/network/if-up.d/upstart 31431
+etc/systemd/logind.conf 31430
+usr/bin/seq 31429
+usr/bin/amixer 31428
+usr/bin/setterm 31427
+etc/init.d/ferm 31426
+etc/default/ferm 31425
+etc/init.d/console-setup 31424
+usr/sbin/ferm 31423
+usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec.pm 31422
+usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec/Unix.pm 31421
+usr/share/consolefonts/Uni1-Fixed16.psf.gz 31420
+etc/ferm/ferm.conf 31419
+sbin/xtables-multi 31418
+lib/libip4tc.so.0.1.0 31417
+lib/libip6tc.so.0.1.0 31416
+lib/libxtables.so.10.0.0 31415
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/x_tables.ko 31414
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/ip_tables.ko 31413
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/nf_conntrack.ko 31412
+etc/console-setup/cached_UTF-8_del.kmap.gz 31411
+bin/gzip 31410
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/nf_nat.ko 31409
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/nf_nat_ipv4.ko 31408
+bin/setfont 31407
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/nf_defrag_ipv4.ko 31406
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/nf_conntrack_ipv4.ko 31405
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/iptable_nat.ko 31404
+etc/protocols 31403
+lib/xtables/libipt_REDIRECT.so 31402
+lib/xtables/libxt_udp.so 31401
+etc/gai.conf 31400
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/nf_nat_redirect.ko 31399
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_REDIRECT.ko 31398
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_tcpudp.ko 31397
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/iptable_filter.ko 31396
+lib/xtables/libxt_state.so 31395
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_conntrack.ko 31394
+lib/xtables/libxt_standard.so 31393
+lib/xtables/libxt_tcp.so 31392
+lib/xtables/libxt_owner.so 31391
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_owner.ko 31390
+lib/xtables/libxt_multiport.so 31389
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_multiport.ko 31388
+etc/services 31387
+lib/xtables/libipt_LOG.so 31386
+lib/xtables/libipt_REJECT.so 31385
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/xt_LOG.ko 31384
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/nf_reject_ipv4.ko 31383
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/ipt_REJECT.ko 31382
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/netfilter/nf_log_common.ko 31381
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv4/netfilter/nf_log_ipv4.ko 31380
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/ip6_tables.ko 31379
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/ip6table_filter.ko 31378
+lib/xtables/libip6t_LOG.so 31377
+lib/xtables/libip6t_REJECT.so 31376
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/nf_reject_ipv6.ko 31375
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/ip6t_REJECT.ko 31374
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/nf_defrag_ipv6.ko 31373
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/nf_conntrack_ipv6.ko 31372
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/ipv6/netfilter/nf_log_ipv6.ko 31371
+etc/default/cron 31370
+usr/sbin/haveged 31369
+etc/ppp/ip-down.d/0000usepeerdns 31368
+usr/sbin/cron 31367
+usr/sbin/ModemManager 31365
+usr/lib/accountsservice/accounts-daemon 31364
+etc/crontab 31363
+lib/systemd/systemd-logind 31362
+usr/local/lib/tails-shell-library/tor.sh 31360
+etc/rc.local 31359
+usr/local/sbin/tails-reconfigure-memlockd 31358
+usr/local/lib/tails-set-wireless-devices-state 31357
+etc/init.d/virtualbox-guest-utils 31356
+usr/local/sbin/tails-reconfigure-kexec 31355
+usr/local/lib/tor-controlport-filter 31354
+etc/init.d/rng-tools 31353
+etc/init.d/speech-dispatcher 31352
+etc/init.d/ekeyd 31351
+etc/default/rng-tools 31350
+etc/init.d/kexec-load 31349
+etc/init.d/spice-vdagent 31348
+etc/dbus-1/system.conf 31347
+etc/dbus-1/system.d/com.hp.hplip.conf 31346
+etc/dbus-1/system.d/com.redhat.NewPrinterNotification.conf 31345
+etc/dbus-1/system.d/com.redhat.PrinterDriversInstaller.conf 31344
+etc/dbus-1/system.d/gdm.conf 31343
+etc/dbus-1/system.d/nm-avahi-autoipd.conf 31342
+etc/dbus-1/system.d/nm-dispatcher.conf 31341
+etc/dbus-1/system.d/org.freedesktop.Accounts.conf 31340
+etc/dbus-1/system.d/org.freedesktop.ColorManager.conf 31339
+etc/dbus-1/system.d/org.freedesktop.ModemManager1.conf 31338
+etc/dbus-1/system.d/org.freedesktop.NetworkManager.conf 31337
+etc/dbus-1/system.d/org.freedesktop.PolicyKit1.conf 31336
+etc/dbus-1/system.d/org.freedesktop.UDisks2.conf 31335
+etc/dbus-1/system.d/org.freedesktop.UPower.conf 31334
+etc/dbus-1/system.d/org.freedesktop.hostname1.conf 31333
+etc/dbus-1/system.d/org.freedesktop.locale1.conf 31332
+etc/dbus-1/system.d/org.freedesktop.login1.conf 31331
+etc/dbus-1/system.d/org.freedesktop.machine1.conf 31330
+etc/default/ekeyd 31329
+etc/default/kexec 31328
+etc/default/speech-dispatcher 31327
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/input/misc/uinput.ko 31326
+bin/echo 31325
+usr/lib/i386-linux-gnu/libhavege.so.1.1.0 31324
+bin/sleep 31323
+etc/dbus-1/system.d/org.freedesktop.systemd1.conf 31322
+etc/dbus-1/system.d/org.freedesktop.timedate1.conf 31321
+etc/dbus-1/system.d/org.opensuse.CupsPkHelper.Mechanism.conf 31320
+etc/dbus-1/system.d/pulseaudio-system.conf 31319
+usr/bin/python3.4 31318
+etc/dbus-1/system.d/wpa_supplicant.conf 31317
+usr/share/dbus-1/system-services/com.hp.hplip.service 31316
+usr/share/dbus-1/system-services/fi.epitest.hostap.WPASupplicant.service 31315
+usr/share/dbus-1/system-services/fi.w1.wpa_supplicant1.service 31314
+usr/share/dbus-1/system-services/org.freedesktop.Accounts.service 31313
+usr/share/dbus-1/system-services/org.freedesktop.ColorManager.service 31312
+usr/share/dbus-1/system-services/org.freedesktop.ModemManager1.service 31311
+usr/share/dbus-1/system-services/org.freedesktop.PolicyKit1.service 31310
+usr/share/dbus-1/system-services/org.freedesktop.UDisks2.service 31309
+usr/share/dbus-1/system-services/org.freedesktop.UPower.service 31308
+usr/share/dbus-1/system-services/org.freedesktop.hostname1.service 31307
+usr/share/dbus-1/system-services/org.freedesktop.locale1.service 31306
+usr/share/dbus-1/system-services/org.freedesktop.login1.service 31305
+usr/share/dbus-1/system-services/org.freedesktop.machine1.service 31304
+usr/share/dbus-1/system-services/org.freedesktop.nm_dispatcher.service 31303
+usr/share/dbus-1/system-services/org.freedesktop.timedate1.service 31302
+usr/share/dbus-1/system-services/org.opensuse.CupsPkHelper.Mechanism.service 31301
+usr/local/bin/tails-get-bootinfo 31289
+lib/systemd/systemd-user-sessions 31279
+sbin/start-stop-daemon 31278
+usr/lib/python3.4/argparse.py 31277
+usr/sbin/ekeyd 31276
+usr/local/bin/tails-boot-to-kexec 31275
+etc/memlockd.cfg 31274
+usr/lib/python3.4/textwrap.py 31258
+etc/X11/default-display-manager 31257
+usr/share/gdm/generate-config 31256
+usr/lib/i386-linux-gnu/liblua5.1.so.0.0.0 31255
+usr/bin/dconf 31253
+usr/sbin/memlockd 31252
+usr/lib/i386-linux-gnu/libstdc++.so.6.0.20 31251
+usr/local/lib/udev-watchdog-wrapper 31250
+usr/sbin/spice-vdagentd 31249
+usr/lib/i386-linux-gnu/libpciaccess.so.0.11.1 31248
+usr/bin/eject 31247
+usr/lib/python3.4/gettext.py 31246
+usr/lib/i386-linux-gnu/libdconf.so.1.0.0 31245
+usr/local/sbin/udev-watchdog 31244
+usr/lib/i386-linux-gnu/libpolkit-gobject-1.so.0.0.0 31243
+etc/gdm3/greeter.dconf-defaults 31242
+usr/share/gdm/dconf/50-tails 31241
+usr/share/gdm/dconf/00-upstream-settings 31240
+usr/share/gdm/dconf/locks/00-upstream-settings-locks 31239
+usr/lib/python3.4/ipaddress.py 31233
+usr/lib/python3/dist-packages/psutil/__init__.py 31232
+usr/sbin/gdm3 31231
+usr/lib/i386-linux-gnu/gio/modules/libgvfsdbus.so 31230
+usr/lib/python3.4/__future__.py 31229
+usr/lib/i386-linux-gnu/libgudev-1.0.so.0.2.0 31226
+usr/lib/i386-linux-gnu/libmm-glib.so.0.2.0 31225
+usr/share/lua/5.1/socket.lua 31223
+usr/lib/i386-linux-gnu/liblua5.1-socket.so.2.0.0 31217
+usr/lib/python3/dist-packages/psutil/_common.py 31216
+usr/lib/i386-linux-gnu/liblua5.1-socket-unix.so.2.0.0 31215
+etc/entropykey/ekeyd.conf 31214
+etc/entropykey/keyring 31213
+usr/lib/python3/dist-packages/psutil/_compat.py 31209
+usr/lib/i386-linux-gnu/libqmi-glib.so.1.2.0 31208
+usr/lib/i386-linux-gnu/gvfs/libgvfscommon.so 31207
+usr/lib/python3/dist-packages/psutil/_pslinux.py 31206
+usr/lib/python3.4/base64.py 31205
+usr/lib/python3/dist-packages/psutil/_psposix.py 31204
+usr/lib/python3/dist-packages/_psutil_linux.cpython-34m-i386-linux-gnu.so 31203
+usr/lib/i386-linux-gnu/libmbim-glib.so.4.0.0 31202
+usr/lib/python3/dist-packages/_psutil_posix.cpython-34m-i386-linux-gnu.so 31201
+usr/lib/python3.4/socketserver.py 31200
+usr/lib/python3/dist-packages/stem/__init__.py 31199
+usr/lib/python3/dist-packages/stem/prereq.py 31198
+lib/i386-linux-gnu/libgcc_s.so.1 31197
+usr/lib/python3.4/inspect.py 31196
+usr/lib/i386-linux-gnu/libbluray.so.1.6.2 31195
+usr/lib/python3.4/ast.py 31194
+usr/lib/python3.4/importlib/__init__.py 31193
+usr/lib/python3.4/importlib/machinery.py 31192
+usr/lib/python3.4/dis.py 31191
+usr/lib/python3.4/opcode.py 31190
+usr/lib/i386-linux-gnu/libfreetype.so.6.11.1 31189
+usr/lib/python3.4/lib-dynload/_opcode.cpython-34m-i386-linux-gnu.so 31188
+usr/lib/python3/dist-packages/stem/util/__init__.py 31187
+usr/lib/python3/dist-packages/stem/util/enum.py 31186
+usr/lib/i386-linux-gnu/libXrandr.so.2.2.0 31185
+usr/lib/i386-linux-gnu/libXrender.so.1.3.0 31184
+usr/lib/python3/dist-packages/stem/util/str_tools.py 31183
+lib/i386-linux-gnu/libpng12.so.0.50.0 31181
+usr/lib/python3/dist-packages/stem/control.py 31180
+usr/bin/ldd 31179
+lib/systemd/system-shutdown/tails-kexec 31178
+etc/gdm3/daemon.conf 31177
+usr/share/gdm/gdm.schemas 31176
+usr/lib/python3.4/calendar.py 31175
+usr/lib/python3.4/queue.py 31174
+usr/lib/python3/dist-packages/stem/descriptor/__init__.py 31173
+lib/systemd/system/systemd-logind.service 31171
+sbin/kexec 31170
+usr/lib/python3.4/lib-dynload/_hashlib.cpython-34m-i386-linux-gnu.so 31168
+usr/lib/python3.4/lib-dynload/_bz2.cpython-34m-i386-linux-gnu.so 31164
+usr/lib/python3/dist-packages/stem/util/system.py 31163
+usr/lib/python3.4/lib-dynload/_ctypes.cpython-34m-i386-linux-gnu.so 31161
+usr/lib/python3.4/distutils/__init__.py 31155
+usr/lib/python3.4/distutils/spawn.py 31154
+usr/lib/python3.4/distutils/errors.py 31153
+usr/lib/python3.4/distutils/debug.py 31152
+usr/lib/python3.4/distutils/log.py 31150
+usr/lib/python3.4/mimetypes.py 31149
+usr/bin/Xorg 31148
+usr/lib/python3.4/urllib/__init__.py 31147
+usr/lib/python3.4/urllib/parse.py 31146
+usr/bin/pgrep 31145
+lib/i386-linux-gnu/libprocps.so.3.0.0 31144
+usr/lib/i386-linux-gnu/libdrm.so.2.4.0 31143
+usr/lib/i386-linux-gnu/libpixman-1.so.0.32.6 31142
+usr/lib/python3.4/platform.py 31141
+usr/lib/python3/dist-packages/stem/util/proc.py 31140
+usr/lib/python3/dist-packages/stem/util/log.py 31139
+usr/lib/python3/dist-packages/stem/descriptor/server_descriptor.py 31136
+lib/live/mount/medium/live/vmlinuz2 31135
+usr/lib/python3/dist-packages/stem/descriptor/extrainfo_descriptor.py 31134
+usr/lib/python3/dist-packages/stem/util/connection.py 31133
+usr/lib/python3.4/hmac.py 31132
+usr/lib/python3/dist-packages/stem/util/conf.py 31131
+usr/lib/python3/dist-packages/stem/exit_policy.py 31130
+usr/lib/python3/dist-packages/stem/util/tor_tools.py 31129
+lib/systemd/system/polkitd.service 31128
+usr/lib/python3/dist-packages/stem/version.py 31127
+usr/lib/python3/dist-packages/stem/descriptor/networkstatus.py 31126
+usr/lib/policykit-1/polkitd 31125
+usr/lib/i386-linux-gnu/libXfont.so.1.4.1 31124
+usr/lib/i386-linux-gnu/libpolkit-backend-1.so.0.0.0 31123
+usr/lib/i386-linux-gnu/libxshmfence.so.1.0.0 31122
+usr/lib/i386-linux-gnu/libfontenc.so.1.0.0 31121
+usr/lib/python3/dist-packages/stem/descriptor/router_status_entry.py 31120
+usr/lib/python3/dist-packages/stem/descriptor/microdescriptor.py 31119
+usr/lib/python3/dist-packages/stem/descriptor/tordnsel.py 31118
+usr/lib/python3/dist-packages/stem/descriptor/hidden_service_descriptor.py 31117
+usr/lib/python3/dist-packages/stem/descriptor/reader.py 31116
+usr/lib/python3/dist-packages/stem/response/__init__.py 31115
+usr/lib/python3/dist-packages/stem/socket.py 31114
+usr/lib/python3/dist-packages/stem/response/events.py 31113
+usr/lib/python3/dist-packages/yaml/__init__.py 31112
+usr/lib/i386-linux-gnu/polkit-1/extensions/libnullbackend.so 31111
+etc/polkit-1/nullbackend.conf.d/50-nullbackend.conf 31110
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-altair-lte.so 31109
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-anydata.so 31108
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-cinterion.so 31107
+usr/lib/python3/dist-packages/yaml/error.py 31106
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-generic.so 31105
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-gobi.so 31104
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-hso.so 31103
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-huawei.so 31102
+usr/lib/python3/dist-packages/yaml/tokens.py 31101
+usr/lib/python3/dist-packages/yaml/events.py 31100
+usr/lib/python3/dist-packages/yaml/nodes.py 31099
+usr/lib/python3/dist-packages/yaml/loader.py 31098
+usr/lib/python3/dist-packages/yaml/reader.py 31097
+usr/lib/python3/dist-packages/yaml/scanner.py 31096
+usr/lib/python3/dist-packages/yaml/parser.py 31095
+usr/lib/python3/dist-packages/yaml/composer.py 31094
+usr/lib/python3/dist-packages/yaml/constructor.py 31093
+usr/lib/python3/dist-packages/yaml/resolver.py 31092
+usr/lib/python3/dist-packages/yaml/dumper.py 31091
+usr/lib/python3/dist-packages/yaml/emitter.py 31090
+usr/lib/python3/dist-packages/yaml/serializer.py 31089
+usr/lib/python3/dist-packages/yaml/representer.py 31088
+usr/lib/python3/dist-packages/yaml/cyaml.py 31087
+usr/lib/python3/dist-packages/_yaml.cpython-34m-i386-linux-gnu.so 31086
+lib/live/mount/medium/live/initrd2.img 31085
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-iridium.so 31084
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-linktop.so 31083
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-longcheer.so 31082
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-mbm.so 31081
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-motorola.so 31080
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-mtk.so 31079
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-nokia-icera.so 31078
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-nokia.so 31077
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-novatel-lte.so 31076
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-novatel.so 31075
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-option.so 31074
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-pantech.so 31073
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-samsung.so 31072
+usr/lib/i386-linux-gnu/libyaml-0.so.2.0.4 31071
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-sierra.so 31070
+usr/lib/python3.4/encodings/idna.py 31069
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-simtech.so 31068
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-telit.so 31067
+usr/lib/python3.4/stringprep.py 31066
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-via.so 31065
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-wavecom.so 31064
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-x22x.so 31063
+usr/lib/i386-linux-gnu/ModemManager/libmm-plugin-zte.so 31062
+usr/lib/xorg/protocol.txt 31060
+usr/share/X11/xorg.conf.d/10-amdgpu.conf 31059
+usr/share/X11/xorg.conf.d/10-evdev.conf 31058
+usr/share/X11/xorg.conf.d/10-quirks.conf 31057
+usr/share/X11/xorg.conf.d/50-synaptics.conf 31056
+usr/share/X11/xorg.conf.d/50-vmmouse.conf 31055
+usr/share/X11/xorg.conf.d/90-tails.conf 31054
+usr/lib/xorg/modules/extensions/libglx.so 31053
+usr/lib/i386-linux-gnu/libGL.so.1.2.0 31052
+usr/lib/i386-linux-gnu/libxcb-dri3.so.0.0.0 31051
+usr/lib/i386-linux-gnu/libxcb-present.so.0.0.0 31050
+usr/lib/i386-linux-gnu/libxcb-sync.so.1.0.0 31049
+usr/lib/i386-linux-gnu/libglapi.so.0.0.0 31048
+usr/lib/i386-linux-gnu/libXdamage.so.1.1.0 31047
+usr/lib/i386-linux-gnu/libXfixes.so.3.1.0 31046
+usr/lib/i386-linux-gnu/libxcb-glx.so.0.0.0 31045
+usr/lib/i386-linux-gnu/libxcb-dri2.so.0.0.0 31044
+usr/lib/i386-linux-gnu/libXxf86vm.so.1.0.0 31043
+usr/lib/xorg/modules/drivers/qxl_drv.so 31042
+usr/lib/xorg/modules/libfb.so 31041
+usr/lib/xorg/modules/libvgahw.so 31040
+usr/lib/i386-linux-gnu/dri/swrast_dri.so 31039
+usr/lib/i386-linux-gnu/libdrm_nouveau.so.2.0.0 31038
+usr/lib/i386-linux-gnu/libdrm_radeon.so.1.0.1 31037
+usr/lib/i386-linux-gnu/libdrm_amdgpu.so.1.0.0 31036
+usr/lib/i386-linux-gnu/libelf-0.159.so 31035
+usr/lib/i386-linux-gnu/libLLVM-3.8.so.1 31034
+usr/lib/i386-linux-gnu/libedit.so.2.0.51 31033
+lib/i386-linux-gnu/libbsd.so.0.7.0 31032
+etc/drirc 31031
+usr/share/fonts/X11/misc/fonts.dir 31030
+usr/share/fonts/X11/misc/fonts.alias 31029
+usr/share/fonts/X11/100dpi/fonts.dir 31028
+usr/share/fonts/X11/100dpi/fonts.alias 31027
+usr/share/fonts/X11/75dpi/fonts.dir 31026
+usr/share/fonts/X11/75dpi/fonts.alias 31025
+usr/share/fonts/X11/Type1/fonts.dir 31024
+usr/share/fonts/X11/misc/6x13-ISO8859-1.pcf.gz 31023
+usr/share/fonts/X11/misc/cursor.pcf.gz 31022
+usr/share/X11/xkb/rules/evdev 31021
+usr/bin/xkbcomp 31020
+usr/lib/i386-linux-gnu/libxkbfile.so.1.0.2 31019
+usr/share/X11/xkb/keycodes/evdev 31018
+usr/share/X11/xkb/geometry/pc 31017
+usr/share/X11/xkb/types/complete 31016
+usr/share/X11/xkb/types/basic 31015
+usr/share/X11/xkb/types/mousekeys 31014
+usr/share/X11/xkb/types/pc 31013
+usr/share/X11/xkb/types/iso9995 31012
+usr/share/X11/xkb/types/level5 31011
+usr/share/X11/xkb/types/extra 31010
+usr/share/X11/xkb/types/numpad 31009
+usr/share/X11/xkb/compat/complete 31008
+usr/share/X11/xkb/compat/basic 31007
+usr/share/X11/xkb/compat/ledcaps 31006
+usr/share/X11/xkb/compat/lednum 31005
+usr/share/X11/xkb/compat/iso9995 31004
+usr/share/X11/xkb/compat/mousekeys 31003
+usr/share/X11/xkb/compat/accessx 31002
+usr/share/X11/xkb/compat/misc 31001
+usr/share/X11/xkb/compat/ledscroll 31000
+usr/share/X11/xkb/compat/xfree86 30999
+usr/share/X11/xkb/compat/level5 30998
+usr/share/X11/xkb/compat/caps 30997
+usr/lib/xorg/modules/input/evdev_drv.so 30996
+usr/lib/i386-linux-gnu/libmtdev.so.1.0.0 30995
+usr/lib/i386-linux-gnu/libevdev.so.2.1.3 30994
+usr/lib/xorg/modules/input/vmmouse_drv.so 30989
+etc/gdm3/Init/Default 30988
+usr/lib/gdm3/gdm-session-worker 30987
+usr/lib/libaccountsservice.so.0.0.0 30986
+etc/pam.d/gdm-launch-environment 30985
+lib/i386-linux-gnu/security/pam_nologin.so 30984
+lib/i386-linux-gnu/security/pam_keyinit.so 30983
+lib/i386-linux-gnu/security/pam_limits.so 30982
+lib/i386-linux-gnu/security/pam_env.so 30981
+usr/share/gdm/BuiltInSessions/default.desktop 30980
+usr/share/polkit-1/actions/com.hp.hplip.policy 30979
+usr/share/polkit-1/actions/com.ubuntu.pkexec.synaptic.policy 30978
+usr/share/polkit-1/actions/org.debian.pkexec.gnome-system-log.policy 30977
+usr/share/polkit-1/actions/org.freedesktop.ModemManager1.policy 30976
+usr/share/polkit-1/actions/org.freedesktop.NetworkManager.policy 30975
+usr/share/polkit-1/actions/org.freedesktop.accounts.policy 30974
+usr/share/polkit-1/actions/org.freedesktop.color.policy 30973
+usr/share/polkit-1/actions/org.freedesktop.hostname1.policy 30972
+usr/share/polkit-1/actions/org.freedesktop.locale1.policy 30971
+usr/share/polkit-1/actions/org.freedesktop.login1.policy 30970
+usr/share/polkit-1/actions/org.freedesktop.policykit.policy 30969
+usr/share/polkit-1/actions/org.freedesktop.systemd1.policy 30968
+usr/share/polkit-1/actions/org.freedesktop.timedate1.policy 30967
+usr/share/polkit-1/actions/org.freedesktop.udisks2.policy 30966
+usr/share/polkit-1/actions/org.gnome.controlcenter.datetime.policy 30965
+usr/share/polkit-1/actions/org.gnome.controlcenter.remote-login-helper.policy 30964
+usr/share/polkit-1/actions/org.gnome.controlcenter.user-accounts.policy 30963
+usr/share/polkit-1/actions/org.gnome.gnome-system-monitor.policy 30962
+usr/share/polkit-1/actions/org.gnome.settings-daemon.plugins.power.policy 30961
+usr/share/polkit-1/actions/org.gnome.settings-daemon.plugins.wacom.policy 30960
+usr/share/polkit-1/actions/org.opensuse.cupspkhelper.mechanism.policy 30959
+usr/share/polkit-1/actions/org.x.xf86-video-intel.backlight-helper.policy 30958
+etc/security/limits.conf 30957
+etc/security/pam_env.conf 30956
+etc/environment 30955
+lib/systemd/system/user@.service 30954
+etc/pam.d/systemd-user 30952
+lib/systemd/systemd 30951
+etc/systemd/user.conf 30945
+lib/systemd/system/shutdown.target 30943
+usr/lib/systemd/user/default.target 30942
+usr/lib/systemd/user/basic.target 30941
+usr/lib/systemd/user/tails-create-tor-browser-directories.service 30940
+usr/lib/systemd/user/tails-add-GNOME-bookmarks.service 30939
+lib/systemd/system/paths.target 30938
+lib/systemd/system/timers.target 30937
+lib/systemd/system/sockets.target 30936
+usr/local/lib/create-tor-browser-directories 30935
+usr/bin/id 30934
+usr/local/lib/add-GNOME-bookmarks 30933
+usr/share/gdm/greeter/dbus-1/services/org.freedesktop.Telepathy.AccountManager.service 30932
+usr/share/gdm/greeter/dbus-1/services/org.freedesktop.Telepathy.MissionControl5.service 30931
+usr/share/gdm/greeter/dbus-1/services/org.gnome.OnlineAccounts.service 30930
+usr/bin/gnome-session 30929
+usr/lib/i386-linux-gnu/libjson-glib-1.0.so.0.0.2 30928
+usr/lib/libgnome-desktop-3.so.10.0.0 30927
+usr/lib/i386-linux-gnu/libgtk-3.so.0.1400.5 30926
+usr/lib/i386-linux-gnu/libgdk-3.so.0.1400.5 30925
+usr/lib/i386-linux-gnu/libcairo.so.2.11400.0 30924
+usr/lib/i386-linux-gnu/libgdk_pixbuf-2.0.so.0.3100.1 30923
+usr/lib/i386-linux-gnu/libpangocairo-1.0.so.0.3600.8 30922
+usr/lib/i386-linux-gnu/libXcomposite.so.1.0.0 30921
+usr/lib/i386-linux-gnu/libcairo-gobject.so.2.11400.0 30920
+usr/lib/i386-linux-gnu/libatk-1.0.so.0.21409.1 30919
+usr/lib/i386-linux-gnu/libatk-bridge-2.0.so.0.0.0 30918
+usr/lib/i386-linux-gnu/libpangoft2-1.0.so.0.3600.8 30917
+usr/lib/i386-linux-gnu/libpango-1.0.so.0.3600.8 30916
+usr/lib/i386-linux-gnu/libfontconfig.so.1.8.0 30915
+usr/lib/i386-linux-gnu/libXinerama.so.1.0.0 30914
+usr/lib/i386-linux-gnu/libXcursor.so.1.0.2 30913
+usr/lib/i386-linux-gnu/libwayland-client.so.0.3.0 30912
+usr/lib/i386-linux-gnu/libxkbcommon.so.0.0.0 30911
+usr/lib/i386-linux-gnu/libwayland-cursor.so.0.0.0 30910
+usr/lib/i386-linux-gnu/libxcb-shm.so.0.0.0 30909
+usr/lib/i386-linux-gnu/libxcb-render.so.0.0.0 30908
+usr/lib/i386-linux-gnu/libatspi.so.0.0.1 30907
+usr/lib/i386-linux-gnu/libharfbuzz.so.0.935.0 30906
+usr/lib/i386-linux-gnu/libthai.so.0.2.0 30905
+usr/lib/i386-linux-gnu/libgraphite2.so.3.0.1 30904
+usr/lib/i386-linux-gnu/libdatrie.so.1.3.1 30903
+usr/lib/gnome-session/gnome-session-check-accelerated 30902
+usr/share/locale/en/LC_MESSAGES/gtk30.mo 30901
+usr/share/locale/en/LC_MESSAGES/gtk30-properties.mo 30900
+usr/lib/at-spi2-core/at-spi-bus-launcher 30899
+usr/share/dconf/profile/gdm 30898
+etc/at-spi2/accessibility.conf 30897
+usr/lib/at-spi2-core/at-spi2-registryd 30896
+usr/lib/gnome-session/gnome-session-check-accelerated-helper 30895
+usr/share/gnome-session/hardware-compatibility 30894
+usr/share/gnome-session/sessions/gdm-tails.session 30893
+usr/share/applications/gnome-flashback.desktop 30892
+usr/share/applications/tails-greeter.desktop 30891
+usr/share/gnome/autostart/gnome-settings-daemon.desktop 30890
+usr/share/applications/metacity.desktop 30889
+usr/share/gdm/greeter/autostart/caribou-autostart.desktop 30888
+usr/share/gdm/greeter/autostart/orca-autostart.desktop 30887
+etc/xdg/autostart/spice-vdagent.desktop 30886
+usr/lib/gnome-settings-daemon/gnome-settings-daemon-localeexec 30885
+usr/bin/spice-vdagent 30884
+usr/lib/gnome-settings-daemon/gnome-settings-daemon 30883
+usr/lib/gnome-settings-daemon-3.0/libgsd.so 30882
+usr/lib/i386-linux-gnu/libnotify.so.4.0.0 30881
+usr/lib/gnome-settings-daemon-3.0/a11y-keyboard.gnome-settings-plugin 30880
+usr/lib/gnome-settings-daemon-3.0/a11y-settings.gnome-settings-plugin 30879
+usr/lib/gnome-settings-daemon-3.0/clipboard.gnome-settings-plugin 30878
+usr/lib/gnome-settings-daemon-3.0/color.gnome-settings-plugin 30877
+usr/lib/gnome-settings-daemon-3.0/cursor.gnome-settings-plugin 30876
+usr/lib/gnome-settings-daemon-3.0/datetime.gnome-settings-plugin 30875
+usr/lib/gnome-settings-daemon-3.0/housekeeping.gnome-settings-plugin 30874
+usr/lib/gnome-settings-daemon-3.0/keyboard.gnome-settings-plugin 30873
+usr/lib/gnome-settings-daemon-3.0/media-keys.gnome-settings-plugin 30872
+usr/lib/gnome-settings-daemon-3.0/mouse.gnome-settings-plugin 30871
+usr/lib/gnome-settings-daemon-3.0/orientation.gnome-settings-plugin 30870
+usr/lib/gnome-settings-daemon-3.0/power.gnome-settings-plugin 30869
+usr/lib/gnome-settings-daemon-3.0/print-notifications.gnome-settings-plugin 30868
+usr/lib/gnome-settings-daemon-3.0/rfkill.gnome-settings-plugin 30867
+usr/lib/gnome-settings-daemon-3.0/screensaver-proxy.gnome-settings-plugin 30866
+usr/lib/gnome-settings-daemon-3.0/sharing.gnome-settings-plugin 30865
+usr/lib/gnome-settings-daemon-3.0/smartcard.gnome-settings-plugin 30864
+usr/lib/gnome-settings-daemon-3.0/sound.gnome-settings-plugin 30863
+usr/lib/gnome-settings-daemon-3.0/updates.gnome-settings-plugin 30862
+usr/lib/gnome-settings-daemon-3.0/wacom.gnome-settings-plugin 30861
+usr/lib/gnome-settings-daemon-3.0/xrandr.gnome-settings-plugin 30860
+usr/lib/gnome-settings-daemon-3.0/xsettings.gnome-settings-plugin 30859
+usr/lib/gnome-settings-daemon-3.0/libpower.so 30858
+usr/lib/i386-linux-gnu/libwacom.so.2.1.0 30857
+usr/lib/i386-linux-gnu/libupower-glib.so.3.0.0 30856
+usr/lib/i386-linux-gnu/libcanberra-gtk3.so.0.1.9 30855
+usr/lib/i386-linux-gnu/libcanberra.so.0.2.5 30854
+usr/lib/i386-linux-gnu/libvorbisfile.so.3.3.6 30853
+usr/lib/i386-linux-gnu/libtdb.so.1.3.6 30852
+usr/lib/i386-linux-gnu/libltdl.so.7.3.0 30851
+lib/systemd/system/upower.service 30850
+usr/lib/upower/upowerd 30849
+lib/i386-linux-gnu/libusb-1.0.so.0.1.0 30848
+usr/lib/i386-linux-gnu/libimobiledevice.so.4.0.1 30847
+usr/lib/i386-linux-gnu/libplist.so.2.0.0 30846
+usr/lib/i386-linux-gnu/libgnutls-deb0.so.28.41.0 30845
+usr/lib/i386-linux-gnu/libtasn1.so.6.3.2 30844
+usr/lib/i386-linux-gnu/libusbmuxd.so.2.1.0 30843
+usr/lib/i386-linux-gnu/libp11-kit.so.0.0.0 30832
+usr/lib/i386-linux-gnu/libnettle.so.4.7 30831
+usr/lib/i386-linux-gnu/libhogweed.so.2.5 30830
+usr/lib/i386-linux-gnu/libgmp.so.10.2.0 30829
+etc/UPower/UPower.conf 30828
+sbin/agetty 30823
+usr/lib/gnome-settings-daemon-3.0/libxsettings.so 30822
+usr/lib/gnome-settings-daemon-3.0/gtk-modules/at-spi2-atk.desktop 30821
+etc/fonts/fonts.conf 30820
+usr/share/fontconfig/conf.avail/10-scale-bitmap-fonts.conf 30819
+usr/share/fontconfig/conf.avail/11-lcdfilter-default.conf 30818
+etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-sans-mono.conf 30817
+etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-sans.conf 30816
+etc/fonts/conf.avail/20-unhint-small-dejavu-lgc-serif.conf 30815
+etc/fonts/conf.avail/20-unhint-small-dejavu-sans-mono.conf 30814
+etc/fonts/conf.avail/20-unhint-small-dejavu-sans.conf 30813
+etc/fonts/conf.avail/20-unhint-small-dejavu-serif.conf 30812
+usr/share/fontconfig/conf.avail/20-unhint-small-vera.conf 30811
+etc/fonts/conf.avail/25-arphic-ukai-render.conf 30810
+etc/fonts/conf.avail/25-arphic-uming-render.conf 30809
+usr/share/fontconfig/conf.avail/30-metric-aliases.conf 30808
+usr/share/fontconfig/conf.avail/30-urw-aliases.conf 30807
+etc/fonts/conf.avail/31-cantarell.conf 30806
+etc/fonts/conf.avail/35-arphic-ukai-aliases.conf 30805
+etc/fonts/conf.avail/35-arphic-uming-aliases.conf 30804
+usr/share/fontconfig/conf.avail/40-nonlatin.conf 30803
+etc/fonts/conf.avail/41-arphic-ukai.conf 30802
+etc/fonts/conf.avail/41-arphic-uming.conf 30801
+usr/share/fontconfig/conf.avail/45-latin.conf 30800
+usr/share/fontconfig/conf.avail/49-sansserif.conf 30799
+usr/share/fontconfig/conf.avail/50-user.conf 30798
+usr/share/fontconfig/conf.avail/51-local.conf 30797
+etc/fonts/conf.avail/57-dejavu-sans-mono.conf 30796
+etc/fonts/conf.avail/57-dejavu-sans.conf 30795
+etc/fonts/conf.avail/57-dejavu-serif.conf 30794
+etc/fonts/conf.avail/58-dejavu-lgc-sans-mono.conf 30793
+etc/fonts/conf.avail/58-dejavu-lgc-sans.conf 30792
+etc/fonts/conf.avail/58-dejavu-lgc-serif.conf 30791
+usr/share/fontconfig/conf.avail/60-latin.conf 30790
+etc/fonts/conf.avail/64-01-tlwg-kinnari.conf 30789
+etc/fonts/conf.avail/64-02-tlwg-norasi.conf 30788
+etc/fonts/conf.avail/64-11-tlwg-waree.conf 30787
+etc/fonts/conf.avail/64-12-tlwg-loma.conf 30786
+etc/fonts/conf.avail/64-13-tlwg-garuda.conf 30785
+etc/fonts/conf.avail/64-14-tlwg-umpush.conf 30784
+etc/fonts/conf.avail/64-15-laksaman.conf 30783
+etc/fonts/conf.avail/64-21-tlwg-typo.conf 30782
+etc/fonts/conf.avail/64-22-tlwg-typist.conf 30781
+etc/fonts/conf.avail/64-23-tlwg-mono.conf 30780
+etc/fonts/conf.avail/64-arphic-uming.conf 30779
+etc/fonts/conf.avail/65-0-fonts-beng-extra.conf/65-0-fonts-beng-extra.conf 30778
+etc/fonts/conf.avail/65-0-fonts-deva-extra.conf/65-0-fonts-deva-extra.conf 30777
+etc/fonts/conf.avail/65-0-fonts-gubbi.conf 30776
+etc/fonts/conf.avail/65-0-fonts-gujr-extra.conf/65-0-fonts-gujr-extra.conf 30775
+etc/fonts/conf.avail/65-0-fonts-guru-extra.conf/65-0-fonts-guru-extra.conf 30774
+etc/fonts/conf.avail/65-0-fonts-orya-extra.conf/65-0-fonts-orya-extra.conf 30773
+etc/fonts/conf.avail/65-0-fonts-pagul.conf 30772
+etc/fonts/conf.avail/malayalam-fonts.conf 30771
+etc/fonts/conf.avail/65-0-fonts-telu-extra.conf 30770
+etc/fonts/conf.avail/65-culmus.conf 30769
+usr/share/fontconfig/conf.avail/65-fonts-persian.conf 30768
+etc/fonts/conf.d/65-khmer.conf 30767
+usr/share/fontconfig/conf.avail/65-nonlatin.conf 30766
+etc/fonts/conf.avail/66-lohit-assamese.conf 30765
+etc/fonts/conf.avail/66-lohit-bengali.conf 30764
+etc/fonts/conf.avail/66-lohit-devanagari.conf 30763
+etc/fonts/conf.avail/66-lohit-gujarati.conf 30762
+etc/fonts/conf.avail/66-lohit-kannada.conf 30761
+etc/fonts/conf.avail/66-lohit-oriya.conf 30760
+etc/fonts/conf.avail/66-lohit-punjabi.conf 30759
+etc/fonts/conf.avail/66-lohit-tamil-classical.conf 30758
+etc/fonts/conf.avail/66-lohit-tamil.conf 30757
+etc/fonts/conf.avail/66-lohit-telugu.conf 30756
+usr/share/fontconfig/conf.avail/69-unifont.conf 30755
+usr/share/fontconfig/conf.avail/70-no-bitmaps.conf 30754
+etc/fonts/conf.avail/75-arphic-ukai-select.conf 30753
+usr/share/fontconfig/conf.avail/80-delicious.conf 30752
+etc/fonts/conf.avail/85-xfonts-wqy.conf/85-wqy-bitmapsong.conf 30751
+etc/fonts/conf.avail/89-tlwg-garuda-synthetic.conf 30750
+etc/fonts/conf.avail/89-tlwg-kinnari-synthetic.conf 30749
+etc/fonts/conf.avail/89-tlwg-laksaman-synthetic.conf 30748
+etc/fonts/conf.avail/89-tlwg-loma-synthetic.conf 30747
+etc/fonts/conf.avail/89-tlwg-umpush-synthetic.conf 30746
+etc/fonts/conf.avail/89-tlwg-waree-synthetic.conf 30745
+etc/fonts/conf.avail/90-arphic-ukai-embolden.conf 30744
+etc/fonts/conf.avail/90-arphic-uming-embolden.conf 30743
+etc/fonts/conf.avail/90-fonts-linux-libertine.conf 30742
+usr/share/fontconfig/conf.avail/90-fonts-unfonts-core.conf 30741
+usr/share/fontconfig/conf.avail/90-synthetic.conf 30740
+etc/fonts/conf.d/99pdftoopvp.conf 30739
+var/cache/fontconfig/3830d5c3ddfd5cd38a049b759396e72e-le32d4.cache-4 30738
+var/cache/fontconfig/4c599c202bc5c08e2d34565a40eac3b2-le32d4.cache-4 30737
+var/cache/fontconfig/c855463f699352c367813e37f3f70ea7-le32d4.cache-4 30736
+var/cache/fontconfig/57e423e26b20ab21d0f2f29c145174c3-le32d4.cache-4 30735
+var/cache/fontconfig/c4f8cd936e32aa63d90660cbbf4d74a0-le32d4.cache-4 30734
+usr/lib/locale/C.UTF-8/LC_CTYPE 30733
+var/cache/fontconfig/573ec803664ed168555e0e8b6d0f0c7f-le32d4.cache-4 30732
+var/cache/fontconfig/2bae36bb929c5b1290cc66cecf2b11b0-le32d4.cache-4 30731
+var/cache/fontconfig/7ef2298fde41cc6eeb7af42e48b7d293-le32d4.cache-4 30730
+var/cache/fontconfig/d82eb4fd963d448e2fcb7d7b793b5df3-le32d4.cache-4 30729
+var/cache/fontconfig/cba07694886bf8bbc441deea9dc5842f-le32d4.cache-4 30728
+var/cache/fontconfig/21a99156bb11811cef641abeda519a45-le32d4.cache-4 30727
+etc/issue 30726
+var/cache/fontconfig/eeebfc908bd29a90773fd860017aada4-le32d4.cache-4 30725
+var/cache/fontconfig/e13b20fdb08344e0e664864cc2ede53d-le32d4.cache-4 30724
+var/cache/fontconfig/707971e003b4ae6c8121c3a920e507f5-le32d4.cache-4 30723
+var/cache/fontconfig/cabbd14511b9e8a55e92af97fb3a0461-le32d4.cache-4 30722
+var/cache/fontconfig/fe547fea3a41b43a38975d292a2b19c7-le32d4.cache-4 30721
+var/cache/fontconfig/f1f2465696798768e9653f19e17ccdc8-le32d4.cache-4 30720
+var/cache/fontconfig/95530828ff6c81d309f8258d8d02a23e-le32d4.cache-4 30719
+var/cache/fontconfig/d3e5c4ee2ceb1fc347f91d4cefc53bc0-le32d4.cache-4 30718
+var/cache/fontconfig/e52a45a1c8c8fe895fc0fc8c4e6999b8-le32d4.cache-4 30717
+var/cache/fontconfig/188ac73a183f12857f63bb60a4a6d603-le32d4.cache-4 30716
+var/cache/fontconfig/cdd862819a105ebd84444cb99c7fc194-le32d4.cache-4 30715
+var/cache/fontconfig/62f91419b9ebdb6975e7e41ab6412357-le32d4.cache-4 30714
+var/cache/fontconfig/c277e94e32b20404286a1ddafa5a80f0-le32d4.cache-4 30713
+var/cache/fontconfig/53d14c92082a93e67d5078324eb314ca-le32d4.cache-4 30712
+var/cache/fontconfig/e0c1a6ba06fd9ea781faace1ebc0ffdd-le32d4.cache-4 30711
+var/cache/fontconfig/f6e6e0a5c3d2f6ae0c0c2e0ecd42a997-le32d4.cache-4 30710
+var/cache/fontconfig/49f0de54bdd920fe4f0dfd4cbac43e6b-le32d4.cache-4 30709
+var/cache/fontconfig/85e0a52ce643a7ba2ae53e5d6949cead-le32d4.cache-4 30708
+var/cache/fontconfig/4d9c95eba1cb85bbcf2878543262124a-le32d4.cache-4 30707
+var/cache/fontconfig/089dead882dea3570ffc31a9898cfb69-le32d4.cache-4 30706
+var/cache/fontconfig/a0513722a37733a9dfd54dccd328039d-le32d4.cache-4 30705
+var/cache/fontconfig/d589a48862398ed80a3d6066f4f56f4c-le32d4.cache-4 30704
+var/cache/fontconfig/75994e804c4bf4eaf913a982c1a8d8e9-le32d4.cache-4 30703
+var/cache/fontconfig/8a687c406b77f27d99abfeeba937fcce-le32d4.cache-4 30702
+var/cache/fontconfig/674d1711f2d1d2a09646eb0bdcadee49-le32d4.cache-4 30701
+var/cache/fontconfig/550f3886151c940c12a5ed35f6a00586-le32d4.cache-4 30700
+var/cache/fontconfig/f259c2cffa685e28062317905db73c4a-le32d4.cache-4 30699
+var/cache/fontconfig/551ecf3b0e8b0bca0f25c0944f561853-le32d4.cache-4 30698
+var/cache/fontconfig/d5178ab6d91b49bf20a416737dcea9e8-le32d4.cache-4 30697
+var/cache/fontconfig/6b2c5944714ca7831b25bed9e85cb5c8-le32d4.cache-4 30696
+var/cache/fontconfig/370e5b74bf5dafc30834de68e24a87a4-le32d4.cache-4 30695
+var/cache/fontconfig/b47c4e1ecd0709278f4910c18777a504-le32d4.cache-4 30694
+var/cache/fontconfig/d512a7b9f4305a5cce37c9b1a598863a-le32d4.cache-4 30693
+var/cache/fontconfig/56cf4f4769d0f4abc89a4895d7bd3ae1-le32d4.cache-4 30692
+var/cache/fontconfig/3047814df9a2f067bd2d96a2b9c36e5a-le32d4.cache-4 30691
+var/cache/fontconfig/564b2e68ac9bc4e36a6f7f6d6125ec1c-le32d4.cache-4 30690
+var/cache/fontconfig/a48eab177a16e4f3713381162db2f3e9-le32d4.cache-4 30689
+var/cache/fontconfig/16c2fda60d1b4b719f4b3d06fd951d25-le32d4.cache-4 30688
+var/cache/fontconfig/3f589640d34b7dc9042c8d453f7c8b9c-le32d4.cache-4 30687
+var/cache/fontconfig/aec30016f93e1b46d1a973dce0d74068-le32d4.cache-4 30686
+var/cache/fontconfig/c5c45a61289222e0d30b1a26ef4effbe-le32d4.cache-4 30685
+var/cache/fontconfig/2171a34dccabdb6bcbbc728186263178-le32d4.cache-4 30684
+var/cache/fontconfig/bab58bb527bb656aaa9f116d68a48d89-le32d4.cache-4 30683
+var/cache/fontconfig/589f83ef4c36d296ce6e1c846f468f08-le32d4.cache-4 30682
+var/cache/fontconfig/f6d4eedfaab2589bde49f7a3ff831d22-le32d4.cache-4 30681
+var/cache/fontconfig/b872e6e592da6075ffa4ab0a1fcc0c75-le32d4.cache-4 30680
+var/cache/fontconfig/c57959a16110560c8d0fcea73374aeeb-le32d4.cache-4 30679
+var/cache/fontconfig/a015930274ffcd967d2ca1b57da47cc7-le32d4.cache-4 30678
+var/cache/fontconfig/4794a0821666d79190d59a36cb4f44b5-le32d4.cache-4 30677
+var/cache/fontconfig/4f3e3037c9980c83b53a9351efadef62-le32d4.cache-4 30676
+var/cache/fontconfig/660208299946a285a940457d1287da33-le32d4.cache-4 30675
+var/cache/fontconfig/14a5e22175779b556eaa434240950366-le32d4.cache-4 30674
+var/cache/fontconfig/dc05db6664285cc2f12bf69c139ae4c3-le32d4.cache-4 30673
+var/cache/fontconfig/04aabc0a78ac019cf9454389977116d2-le32d4.cache-4 30672
+var/cache/fontconfig/6d41288fd70b0be22e8c3a91e032eec0-le32d4.cache-4 30671
+var/cache/fontconfig/a6d8cf8e4ec09cdbc8633c31745a07dd-le32d4.cache-4 30670
+var/cache/fontconfig/0fafd173547752dce4dee1a69e0b3c95-le32d4.cache-4 30669
+var/cache/fontconfig/945677eb7aeaf62f1d50efc3fb3ec7d8-le32d4.cache-4 30668
+var/cache/fontconfig/087e1975ba9a574b140bb1df193bf770-le32d4.cache-4 30667
+var/cache/fontconfig/6333f38776742d18e214673cd2c24e34-le32d4.cache-4 30666
+usr/lib/gnome-settings-daemon-3.0/libxrandr.so 30665
+usr/lib/gnome-settings-daemon-3.0/libsound.so 30664
+usr/lib/gnome-settings-daemon-3.0/libkeyboard.so 30663
+usr/lib/gnome-settings-daemon-3.0/liba11y-settings.so 30662
+usr/lib/gnome-settings-daemon-3.0/liba11y-keyboard.so 30661
+usr/lib/gnome-settings-daemon-3.0/libsmartcard.so 30660
+usr/lib/i386-linux-gnu/libnss3.so 30659
+usr/lib/i386-linux-gnu/libnspr4.so 30658
+usr/lib/i386-linux-gnu/libnssutil3.so 30657
+usr/lib/i386-linux-gnu/libplc4.so 30656
+usr/lib/i386-linux-gnu/libplds4.so 30655
+usr/lib/gnome-settings-daemon-3.0/libcolor.so 30654
+usr/lib/i386-linux-gnu/libcolord.so.2.0.1 30653
+usr/lib/i386-linux-gnu/libcolordprivate.so.2.0.1 30652
+usr/lib/i386-linux-gnu/liblcms2.so.2.0.6 30651
+usr/lib/gnome-settings-daemon-3.0/liborientation.so 30650
+usr/lib/gnome-settings-daemon-3.0/libmedia-keys.so 30649
+usr/lib/i386-linux-gnu/libpulse-mainloop-glib.so.0.0.5 30648
+usr/lib/gnome-settings-daemon-3.0/libclipboard.so 30647
+var/lib/polkit-1/localauthority/10-vendor.d/org.freedesktop.NetworkManager.pkla 30646
+var/lib/polkit-1/localauthority/10-vendor.d/gnome-control-center.pkla 30645
+etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.pkla 30644
+etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.cups.pkla 30643
+etc/polkit-1/localauthority/10-vendor.d/org.boum.tails.accounts.pkla 30642
+lib/systemd/system/colord.service 30641
+usr/bin/metacity 30640
+usr/lib/i386-linux-gnu/libstartup-notification-1.so.0.0.0 30639
+usr/lib/libgtop-2.0.so.7.2.0 30638
+usr/lib/i386-linux-gnu/libxcb-util.so.0.0.0 30637
+usr/lib/colord/colord 30636
+usr/lib/i386-linux-gnu/libsqlite3.so.0.8.6 30635
+usr/lib/i386-linux-gnu/nss/libsoftokn3.so 30634
+usr/lib/i386-linux-gnu/nss/libnssdbm3.so 30633
+usr/lib/i386-linux-gnu/libgusb.so.2.0.3 30632
+usr/lib/i386-linux-gnu/nss/libfreeblpriv3.so 30631
+usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders.cache 30630
+usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_camera.so 30629
+usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_sane.so 30628
+usr/lib/i386-linux-gnu/colord-plugins/libcd_plugin_scanner.so 30627
+usr/share/mime/mime.cache 30626
+usr/bin/pulseaudio 30625
+usr/share/themes/Default/gtk-3.0/gtk-keys.css 30624
+usr/lib/libpulsecore-5.0.so 30623
+usr/share/X11/locale/locale.alias 30622
+usr/share/X11/locale/locale.dir 30621
+usr/share/X11/locale/en_US.UTF-8/XLC_LOCALE 30620
+usr/share/themes/Adwaita/metacity-1/metacity-theme-3.xml 30619
+usr/lib/i386-linux-gnu/libsamplerate.so.0.1.8 30618
+usr/bin/gnome-flashback 30617
+usr/share/color/icc/colord/BestRGB.icc 30616
+usr/share/color/icc/colord/BetaRGB.icc 30615
+usr/share/color/icc/colord/BruceRGB.icc 30614
+usr/share/color/icc/colord/Crayons.icc 30613
+usr/share/color/icc/colord/DonRGB4.icc 30612
+usr/share/color/icc/colord/ECI-RGBv1.icc 30611
+usr/share/color/icc/colord/ECI-RGBv2.icc 30610
+usr/share/color/icc/colord/EktaSpacePS5.icc 30609
+usr/share/color/icc/colord/FOGRA27L_coated.icc 30608
+usr/share/icons/Adwaita/cursors/left_ptr 30607
+usr/share/color/icc/colord/FOGRA28L_webcoated.icc 30606
+usr/lib/i386-linux-gnu/sse2/libspeexdsp.so.1.5.0 30605
+usr/share/color/icc/colord/FOGRA29L_uncoated.icc 30604
+usr/lib/i386-linux-gnu/liborc-0.4.so.0.22.0 30603
+usr/share/color/icc/colord/FOGRA30L_uncoated_yellowish.icc 30602
+usr/bin/tails-greeter 30601
+usr/share/color/icc/colord/FOGRA39L_coated.icc 30600
+usr/share/color/icc/colord/FOGRA40L_SC_paper.icc 30599
+usr/share/tails-greeter/tails-greeter.py 30598
+usr/lib/python2.7/dist-packages/gi/__init__.py 30597
+usr/lib/python2.7/pkgutil.py 30596
+usr/lib/python2.7/importlib/__init__.py 30595
+usr/lib/python2.7/dist-packages/gi/_gi.so 30594
+usr/share/color/icc/colord/FOGRA45L_lwc.icc 30593
+usr/lib/i386-linux-gnu/libgirepository-1.0.so.1.0.0 30592
+usr/share/color/icc/colord/FOGRA47L_uncoated.icc 30591
+usr/share/color/icc/colord/GRACoL_TR006_coated.icc 30590
+usr/lib/python2.7/dist-packages/gi/_error.py 30589
+usr/share/color/icc/colord/Gamma5000K.icc 30588
+usr/lib/python2.7/logging/__init__.py 30587
+usr/share/color/icc/colord/Gamma5500K.icc 30586
+etc/pulse/daemon.conf 30585
+usr/lib/python2.7/collections.py 30584
+usr/share/color/icc/colord/Gamma6500K.icc 30583
+usr/lib/python2.7/keyword.py 30582
+usr/lib/python2.7/heapq.py 30581
+usr/lib/python2.7/threading.py 30580
+usr/share/color/icc/colord/IFRA26S_2004_newsprint.icc 30579
+usr/share/icons/Adwaita/index.theme 30578
+usr/lib/python2.7/atexit.py 30577
+usr/share/color/icc/colord/SNAP_TR002_newsprint.icc 30576
+usr/share/icons/gnome/index.theme 30575
+usr/share/color/icc/colord/SWOP_TR003_coated_3.icc 30574
+usr/share/color/icc/colord/SWOP_TR005_coated_5.icc 30573
+etc/pulse/default.pa 30572
+usr/lib/pulse-5.0/modules/module-device-restore.so 30571
+usr/lib/pulse-5.0/modules/libprotocol-native.so 30570
+usr/lib/python2.7/logging/config.py 30569
+usr/share/color/icc/colord/WideGamutRGB.icc 30568
+usr/lib/pulse-5.0/modules/module-stream-restore.so 30567
+usr/share/icons/hicolor/index.theme 30566
+usr/share/color/icc/ghostscript/default_cmyk.icc 30565
+usr/lib/python2.7/io.py 30564
+usr/lib/python2.7/logging/handlers.py 30563
+usr/share/color/icc/ghostscript/default_gray.icc 30562
+usr/lib/pulse-5.0/modules/module-card-restore.so 30561
+usr/lib/pulse-5.0/modules/module-augment-properties.so 30560
+usr/share/color/icc/ghostscript/default_rgb.icc 30559
+usr/lib/python2.7/socket.py 30558
+usr/lib/python2.7/lib-dynload/_ssl.i386-linux-gnu.so 30557
+usr/share/color/icc/ghostscript/gray_to_k.icc 30556
+usr/lib/pulse-5.0/modules/module-switch-on-port-available.so 30555
+usr/share/color/icc/ghostscript/lab.icc 30554
+usr/share/color/icc/ghostscript/ps_cmyk.icc 30553
+usr/share/color/icc/ghostscript/ps_gray.icc 30552
+usr/share/color/icc/ghostscript/ps_rgb.icc 30551
+usr/share/color/icc/ghostscript/sgray.icc 30550
+usr/share/color/icc/ghostscript/srgb.icc 30549
+usr/lib/colord/colord-sane 30548
+usr/lib/i386-linux-gnu/libsane.so.1.0.24 30547
+usr/share/icons/Adwaita/16x16/status/audio-volume-muted.png 30546
+usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders/libpixbufloader-png.so 30545
+usr/lib/pulse-5.0/modules/module-udev-detect.so 30544
+usr/lib/pulse-5.0/modules/module-alsa-card.so 30543
+usr/lib/pulse-5.0/modules/libalsa-util.so 30542
+usr/lib/python2.7/SocketServer.py 30541
+usr/lib/i386-linux-gnu/girepository-1.0/Gtk-3.0.typelib 30540
+usr/lib/python2.7/dist-packages/gi/repository/__init__.py 30539
+usr/lib/python2.7/dist-packages/gi/importer.py 30538
+usr/lib/python2.7/dist-packages/gi/module.py 30537
+usr/lib/python2.7/dist-packages/gi/overrides/__init__.py 30536
+usr/lib/python2.7/dist-packages/gi/_constants.py 30535
+usr/share/pulseaudio/alsa-mixer/profile-sets/extra-hdmi.conf 30534
+usr/share/fonts/opentype/cantarell/Cantarell-Regular.otf 30533
+usr/lib/python2.7/dist-packages/gi/types.py 30532
+usr/lib/python2.7/dist-packages/gi/docstring.py 30531
+usr/lib/python2.7/dist-packages/gi/_propertyhelper.py 30530
+etc/sane.d/dll.d/hplip 30529
+etc/sane.d/dll.conf 30528
+usr/lib/i386-linux-gnu/sane/libsane-xerox_mfp.so.1.0.24 30527
+usr/lib/python2.7/dist-packages/gi/_signalhelper.py 30526
+usr/share/icons/Adwaita/16x16/status/microphone-sensitivity-muted.png 30525
+usr/lib/python2.7/inspect.py 30524
+etc/sane.d/xerox_mfp.conf 30523
+usr/lib/i386-linux-gnu/sane/libsane-v4l.so.1.0.24 30522
+usr/lib/python2.7/dis.py 30521
+usr/lib/python2.7/opcode.py 30520
+usr/lib/python2.7/tokenize.py 30519
+usr/lib/i386-linux-gnu/libv4l1.so.0.0.0 30518
+usr/lib/python2.7/token.py 30517
+usr/lib/i386-linux-gnu/libv4l2.so.0.0.0 30516
+usr/lib/i386-linux-gnu/libv4lconvert.so.0.0.0 30515
+usr/lib/i386-linux-gnu/libjpeg.so.62.1.0 30514
+usr/lib/i386-linux-gnu/girepository-1.0/xlib-2.0.typelib 30513
+usr/lib/i386-linux-gnu/girepository-1.0/Gdk-3.0.typelib 30512
+usr/share/alsa/cards/aliases.conf 30511
+usr/share/alsa/pcm/default.conf 30510
+usr/share/alsa/pcm/dmix.conf 30509
+usr/share/alsa/pcm/dsnoop.conf 30508
+usr/share/alsa/cards/HDA-Intel.conf 30507
+usr/lib/i386-linux-gnu/girepository-1.0/cairo-1.0.typelib 30506
+usr/lib/i386-linux-gnu/girepository-1.0/Pango-1.0.typelib 30505
+usr/lib/i386-linux-gnu/girepository-1.0/GObject-2.0.typelib 30504
+usr/lib/i386-linux-gnu/girepository-1.0/GLib-2.0.typelib 30503
+etc/sane.d/v4l.conf 30502
+usr/lib/i386-linux-gnu/sane/libsane-umax1220u.so.1.0.24 30501
+usr/share/alsa/pcm/front.conf 30500
+usr/share/alsa/pcm/surround21.conf 30499
+etc/sane.d/umax1220u.conf 30498
+usr/lib/i386-linux-gnu/sane/libsane-umax.so.1.0.24 30497
+usr/lib/i386-linux-gnu/girepository-1.0/Gio-2.0.typelib 30496
+usr/share/alsa/pcm/surround40.conf 30495
+usr/share/alsa/pcm/surround41.conf 30494
+usr/share/alsa/pcm/surround50.conf 30493
+usr/share/alsa/pcm/surround51.conf 30492
+usr/share/alsa/pcm/surround71.conf 30491
+usr/share/alsa/pcm/iec958.conf 30490
+usr/share/alsa/pcm/hdmi.conf 30489
+usr/share/alsa/pcm/modem.conf 30488
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-front-mic.conf 30487
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic.conf.common 30486
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-rear-mic.conf 30485
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-internal-mic.conf 30484
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-dock-mic.conf 30483
+usr/share/pulseaudio/alsa-mixer/paths/analog-input.conf 30482
+usr/share/pulseaudio/alsa-mixer/paths/analog-input.conf.common 30481
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic.conf 30480
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-linein.conf 30479
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-aux.conf 30478
+usr/lib/girepository-1.0/GdkPixbuf-2.0.typelib 30477
+usr/lib/i386-linux-gnu/girepository-1.0/GModule-2.0.typelib 30476
+usr/lib/girepository-1.0/Atk-1.0.typelib 30475
+usr/lib/python2.7/dist-packages/gi/overrides/Gtk.py 30474
+etc/sane.d/umax.conf 30473
+usr/lib/i386-linux-gnu/sane/libsane-u12.so.1.0.24 30472
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-video.conf 30471
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-tvtuner.conf 30470
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-fm.conf 30469
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-mic-line.conf 30468
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-headphone-mic.conf 30467
+usr/share/pulseaudio/alsa-mixer/paths/analog-input-headset-mic.conf 30466
+etc/sane.d/u12.conf 30465
+usr/lib/i386-linux-gnu/sane/libsane-teco3.so.1.0.24 30464
+etc/sane.d/teco3.conf 30463
+usr/lib/i386-linux-gnu/sane/libsane-teco2.so.1.0.24 30462
+etc/sane.d/teco2.conf 30461
+usr/lib/python2.7/dist-packages/gi/overrides/GObject.py 30460
+usr/lib/i386-linux-gnu/sane/libsane-teco1.so.1.0.24 30459
+etc/sane.d/teco1.conf 30458
+usr/lib/i386-linux-gnu/sane/libsane-tamarack.so.1.0.24 30457
+usr/lib/python2.7/dist-packages/gi/overrides/GLib.py 30456
+usr/share/pulseaudio/alsa-mixer/paths/analog-output.conf 30455
+usr/lib/python2.7/dist-packages/gi/_option.py 30454
+etc/sane.d/tamarack.conf 30453
+usr/lib/i386-linux-gnu/sane/libsane-sp15c.so.1.0.24 30452
+usr/share/pulseaudio/alsa-mixer/paths/analog-output.conf.common 30451
+usr/share/pulseaudio/alsa-mixer/paths/analog-output-lineout.conf 30450
+usr/share/pulseaudio/alsa-mixer/paths/analog-output-speaker.conf 30449
+etc/sane.d/sp15c.conf 30448
+usr/lib/i386-linux-gnu/sane/libsane-snapscan.so.1.0.24 30447
+usr/share/pulseaudio/alsa-mixer/paths/analog-output-desktop-speaker.conf 30446
+usr/share/pulseaudio/alsa-mixer/paths/analog-output-headphones.conf 30445
+usr/share/pulseaudio/alsa-mixer/paths/analog-output-headphones-2.conf 30444
+etc/sane.d/snapscan.conf 30443
+usr/lib/i386-linux-gnu/sane/libsane-sm3840.so.1.0.24 30442
+usr/lib/i386-linux-gnu/sane/libsane-sm3600.so.1.0.24 30441
+usr/lib/i386-linux-gnu/sane/libsane-sharp.so.1.0.24 30440
+etc/sane.d/sharp.conf 30439
+usr/lib/i386-linux-gnu/sane/libsane-sceptre.so.1.0.24 30438
+usr/lib/pulse-5.0/modules/module-native-protocol-unix.so 30437
+usr/lib/pulse-5.0/modules/module-default-device-restore.so 30436
+usr/lib/pulse-5.0/modules/module-rescue-streams.so 30435
+usr/lib/pulse-5.0/modules/module-always-sink.so 30434
+usr/lib/pulse-5.0/modules/module-intended-roles.so 30433
+usr/lib/pulse-5.0/modules/module-suspend-on-idle.so 30432
+etc/sane.d/sceptre.conf 30431
+usr/lib/i386-linux-gnu/sane/libsane-s9036.so.1.0.24 30430
+etc/sane.d/s9036.conf 30429
+usr/lib/i386-linux-gnu/sane/libsane-rts8891.so.1.0.24 30428
+usr/lib/python2.7/dist-packages/tailsgreeter/__init__.py 30427
+usr/lib/python2.7/dist-packages/tailsgreeter/errors.py 30426
+usr/lib/python2.7/dist-packages/tailsgreeter/gdmclient.py 30425
+usr/lib/girepository-1.0/Gdm-1.0.typelib 30424
+usr/lib/python2.7/dist-packages/tailsgreeter/config.py 30423
+usr/lib/python2.7/ConfigParser.py 30422
+usr/lib/pulse-5.0/modules/module-console-kit.so 30421
+usr/lib/pulse-5.0/modules/module-systemd-login.so 30420
+usr/lib/pulse-5.0/modules/module-position-event-sounds.so 30419
+etc/sane.d/rts8891.conf 30418
+usr/lib/i386-linux-gnu/sane/libsane-ricoh.so.1.0.24 30417
+etc/sane.d/ricoh.conf 30416
+usr/lib/i386-linux-gnu/sane/libsane-qcam.so.1.0.24 30415
+etc/sane.d/qcam.conf 30414
+usr/lib/i386-linux-gnu/sane/libsane-plustek.so.1.0.24 30413
+usr/lib/pulse-5.0/modules/module-role-cork.so 30412
+usr/share/tails-greeter/tails-logging.conf 30411
+usr/lib/python2.7/pipes.py 30410
+usr/lib/pulse-5.0/modules/module-filter-heuristics.so 30409
+usr/lib/python2.7/tempfile.py 30408
+etc/sane.d/plustek.conf 30407
+usr/lib/i386-linux-gnu/sane/libsane-pixma.so.1.0.24 30406
+usr/lib/python2.7/dist-packages/tailsgreeter/rootaccess.py 30405
+usr/lib/python2.7/dist-packages/tailsgreeter/persistence.py 30404
+usr/lib/python2.7/subprocess.py 30403
+usr/lib/pulse-5.0/modules/module-filter-apply.so 30402
+usr/lib/python2.7/pickle.py 30401
+usr/lib/python2.7/dist-packages/tailsgreeter/utils.py 30400
+usr/lib/python2.7/dist-packages/tailsgreeter/physicalsecurity.py 30399
+usr/lib/python2.7/dist-packages/tailsgreeter/language.py 30398
+usr/lib/python2.7/dist-packages/pycountry/__init__.py 30397
+usr/lib/python2.7/dist-packages/pycountry/db.py 30396
+etc/sane.d/pixma.conf 30395
+usr/lib/python2.7/xml/__init__.py 30394
+usr/lib/python2.7/xml/dom/__init__.py 30393
+usr/lib/python2.7/xml/dom/domreg.py 30392
+usr/lib/python2.7/xml/dom/minicompat.py 30391
+usr/lib/python2.7/xml/dom/minidom.py 30390
+usr/lib/python2.7/xml/dom/xmlbuilder.py 30389
+usr/lib/python2.7/xml/dom/NodeFilter.py 30388
+usr/lib/python2.7/dist-packages/pkg_resources.py 30387
+usr/lib/python2.7/zipfile.py 30386
+usr/share/tails/desktop_wallpaper.png 30385
+usr/lib/python2.7/shutil.py 30384
+usr/lib/python2.7/fnmatch.py 30383
+usr/lib/python2.7/symbol.py 30382
+usr/lib/python2.7/platform.py 30381
+lib/systemd/system/systemd-localed.service 30380
+usr/lib/python2.7/plistlib.py 30379
+usr/lib/python2.7/email/__init__.py 30378
+usr/lib/python2.7/email/mime/__init__.py 30377
+usr/lib/python2.7/email/parser.py 30376
+usr/lib/python2.7/email/feedparser.py 30375
+lib/systemd/systemd-localed 30374
+usr/lib/python2.7/email/errors.py 30373
+usr/lib/python2.7/email/message.py 30372
+usr/lib/python2.7/uu.py 30371
+usr/share/icons/Adwaita/16x16/status/audio-volume-medium.png 30370
+usr/lib/python2.7/email/charset.py 30369
+usr/lib/python2.7/email/base64mime.py 30368
+usr/lib/python2.7/email/utils.py 30367
+usr/lib/python2.7/base64.py 30366
+usr/share/icons/Adwaita/16x16/status/microphone-sensitivity-high.png 30365
+usr/lib/python2.7/urllib.py 30364
+usr/lib/dconf/dconf-service 30363
+usr/lib/python2.7/urlparse.py 30362
+usr/lib/i386-linux-gnu/sane/libsane-pie.so.1.0.24 30361
+etc/sane.d/pie.conf 30360
+usr/lib/i386-linux-gnu/sane/libsane-niash.so.1.0.24 30359
+usr/lib/i386-linux-gnu/sane/libsane-nec.so.1.0.24 30358
+etc/sane.d/nec.conf 30357
+usr/lib/i386-linux-gnu/sane/libsane-mustek_usb2.so.1.0.24 30356
+usr/lib/python2.7/ssl.py 30355
+usr/lib/python2.7/contextlib.py 30354
+usr/lib/i386-linux-gnu/sane/libsane-mustek_usb.so.1.0.24 30353
+usr/lib/python2.7/email/_parseaddr.py 30352
+usr/lib/python2.7/calendar.py 30351
+usr/lib/python2.7/quopri.py 30350
+usr/lib/python2.7/email/encoders.py 30349
+usr/lib/python2.7/email/quoprimime.py 30348
+usr/lib/python2.7/email/iterators.py 30347
+usr/lib/python2.7/lib-dynload/parser.i386-linux-gnu.so 30346
+etc/sane.d/mustek_usb.conf 30345
+usr/lib/i386-linux-gnu/sane/libsane-mustek.so.1.0.24 30344
+usr/lib/python2.7/dist-packages/matplotlib-1.4.2.egg-info/namespace_packages.txt 30343
+usr/lib/python2.7/dist-packages/protobuf-2.6.1.egg-info/namespace_packages.txt 30342
+usr/lib/i386-linux-gnu/libieee1284.so.3.2.2 30341
+etc/sane.d/mustek.conf 30340
+usr/share/xml/iso-codes/iso_3166.xml 30339
+usr/lib/i386-linux-gnu/sane/libsane-microtek2.so.1.0.24 30338
+usr/lib/python2.7/xml/dom/expatbuilder.py 30337
+usr/lib/python2.7/xml/parsers/__init__.py 30336
+usr/lib/python2.7/xml/parsers/expat.py 30335
+usr/lib/python2.7/lib-dynload/pyexpat.i386-linux-gnu.so 30334
+etc/sane.d/microtek2.conf 30333
+usr/lib/i386-linux-gnu/sane/libsane-microtek.so.1.0.24 30332
+etc/sane.d/microtek.conf 30331
+usr/lib/i386-linux-gnu/sane/libsane-matsushita.so.1.0.24 30330
+etc/sane.d/matsushita.conf 30329
+usr/lib/i386-linux-gnu/sane/libsane-magicolor.so.1.0.24 30328
+etc/sane.d/magicolor.conf 30327
+usr/lib/i386-linux-gnu/sane/libsane-ma1509.so.1.0.24 30326
+etc/sane.d/ma1509.conf 30325
+usr/lib/i386-linux-gnu/sane/libsane-lexmark.so.1.0.24 30324
+usr/share/xml/iso-codes/iso_15924.xml 30323
+etc/sane.d/lexmark.conf 30322
+usr/lib/i386-linux-gnu/sane/libsane-leo.so.1.0.24 30321
+etc/sane.d/leo.conf 30320
+usr/lib/i386-linux-gnu/sane/libsane-kvs20xx.so.1.0.24 30319
+usr/share/xml/iso-codes/iso_4217.xml 30318
+usr/share/xml/iso-codes/iso_639.xml 30317
+usr/lib/i386-linux-gnu/sane/libsane-kvs1025.so.1.0.24 30316
+usr/lib/i386-linux-gnu/sane/libsane-kodakaio.so.1.0.24 30315
+usr/lib/i386-linux-gnu/libavahi-common.so.3.5.3 30314
+usr/lib/i386-linux-gnu/libavahi-client.so.3.2.9 30313
+etc/sane.d/kodakaio.conf 30312
+usr/lib/i386-linux-gnu/sane/libsane-kodak.so.1.0.24 30311
+usr/share/xml/iso-codes/iso_3166_2.xml 30310
+etc/sane.d/kodak.conf 30309
+usr/lib/i386-linux-gnu/sane/libsane-ibm.so.1.0.24 30308
+etc/sane.d/ibm.conf 30307
+usr/lib/i386-linux-gnu/sane/libsane-hs2p.so.1.0.24 30306
+etc/sane.d/hs2p.conf 30305
+usr/lib/i386-linux-gnu/sane/libsane-hpljm1005.so.1.0.24 30304
+usr/lib/i386-linux-gnu/sane/libsane-hp5590.so.1.0.24 30303
+usr/lib/i386-linux-gnu/sane/libsane-hp5400.so.1.0.24 30302
+etc/sane.d/hp5400.conf 30301
+usr/lib/i386-linux-gnu/sane/libsane-hp4200.so.1.0.24 30300
+etc/sane.d/hp4200.conf 30299
+usr/lib/i386-linux-gnu/sane/libsane-hp3500.so.1.0.24 30298
+usr/lib/i386-linux-gnu/sane/libsane-hpsj5s.so.1.0.24 30297
+etc/sane.d/hpsj5s.conf 30296
+usr/lib/i386-linux-gnu/sane/libsane-hp3900.so.1.0.24 30295
+usr/lib/i386-linux-gnu/libtiff.so.5.2.0 30294
+usr/lib/i386-linux-gnu/libjbig.so.0 30293
+etc/sane.d/hp3900.conf 30292
+usr/lib/i386-linux-gnu/sane/libsane-hp.so.1.0.24 30291
+etc/sane.d/hp.conf 30290
+usr/lib/i386-linux-gnu/sane/libsane-gt68xx.so.1.0.24 30289
+etc/sane.d/gt68xx.conf 30288
+usr/lib/i386-linux-gnu/sane/libsane-genesys.so.1.0.24 30287
+etc/sane.d/genesys.conf 30286
+usr/lib/i386-linux-gnu/sane/libsane-fujitsu.so.1.0.24 30285
+etc/sane.d/fujitsu.conf 30284
+usr/lib/i386-linux-gnu/sane/libsane-epson2.so.1.0.24 30283
+etc/sane.d/epson2.conf 30282
+usr/lib/python2.7/dist-packages/icu.py 30281
+usr/lib/python2.7/dist-packages/icu_docs.py 30280
+usr/lib/python2.7/dist-packages/_icu.so 30279
+usr/lib/i386-linux-gnu/libicui18n.so.52.1 30278
+usr/lib/i386-linux-gnu/libicuuc.so.52.1 30277
+usr/lib/i386-linux-gnu/libicudata.so.52.1 30276
+usr/lib/i386-linux-gnu/sane/libsane-epjitsu.so.1.0.24 30275
+etc/sane.d/epjitsu.conf 30274
+usr/lib/i386-linux-gnu/sane/libsane-dmc.so.1.0.24 30273
+etc/sane.d/dmc.conf 30272
+usr/lib/i386-linux-gnu/libicule.so.52.1 30271
+usr/lib/i386-linux-gnu/sane/libsane-dell1600n_net.so.1.0.24 30270
+etc/sane.d/dell1600n_net.conf 30269
+usr/lib/i386-linux-gnu/sane/libsane-coolscan3.so.1.0.24 30268
+etc/sane.d/coolscan3.conf 30267
+usr/lib/i386-linux-gnu/sane/libsane-coolscan.so.1.0.24 30266
+etc/sane.d/coolscan.conf 30265
+usr/lib/i386-linux-gnu/sane/libsane-cardscan.so.1.0.24 30264
+etc/sane.d/cardscan.conf 30263
+usr/lib/i386-linux-gnu/sane/libsane-canon_dr.so.1.0.24 30262
+etc/sane.d/canon_dr.conf 30261
+usr/lib/i386-linux-gnu/sane/libsane-canon630u.so.1.0.24 30260
+etc/sane.d/canon630u.conf 30259
+usr/lib/i386-linux-gnu/sane/libsane-canon.so.1.0.24 30258
+etc/sane.d/canon.conf 30257
+usr/lib/i386-linux-gnu/sane/libsane-bh.so.1.0.24 30256
+etc/sane.d/bh.conf 30255
+usr/lib/i386-linux-gnu/sane/libsane-as6e.so.1.0.24 30254
+usr/lib/i386-linux-gnu/sane/libsane-artec_eplus48u.so.1.0.24 30253
+etc/sane.d/artec_eplus48u.conf 30252
+usr/lib/i386-linux-gnu/sane/libsane-artec.so.1.0.24 30251
+etc/sane.d/artec.conf 30250
+usr/lib/i386-linux-gnu/sane/libsane-avision.so.1.0.24 30249
+etc/sane.d/avision.conf 30248
+usr/lib/i386-linux-gnu/sane/libsane-apple.so.1.0.24 30247
+etc/sane.d/apple.conf 30246
+usr/lib/i386-linux-gnu/sane/libsane-agfafocus.so.1.0.24 30245
+etc/sane.d/agfafocus.conf 30244
+usr/lib/i386-linux-gnu/sane/libsane-abaton.so.1.0.24 30243
+etc/sane.d/abaton.conf 30242
+usr/lib/i386-linux-gnu/sane/libsane-net.so.1.0.24 30241
+usr/share/zoneinfo/Africa/Timbuktu 30240
+etc/sane.d/net.conf 30239
+usr/lib/i386-linux-gnu/sane/libsane-hpaio.so.1.0.0 30238
+usr/share/zoneinfo/Africa/Accra 30237
+usr/share/zoneinfo/Indian/Antananarivo 30236
+usr/share/zoneinfo/Africa/Algiers 30235
+usr/share/zoneinfo/Africa/Bangui 30234
+usr/share/zoneinfo/Africa/Bissau 30233
+usr/share/zoneinfo/Africa/Blantyre 30232
+usr/share/zoneinfo/Egypt 30231
+usr/share/zoneinfo/Africa/Casablanca 30230
+usr/share/zoneinfo/Africa/Ceuta 30229
+usr/share/zoneinfo/Africa/El_Aaiun 30228
+usr/share/zoneinfo/Africa/Mbabane 30227
+usr/share/zoneinfo/Africa/Juba 30226
+usr/share/zoneinfo/Africa/Monrovia 30225
+usr/share/zoneinfo/Africa/Ndjamena 30224
+usr/lib/i386-linux-gnu/libhpip.so.0.0.1 30223
+usr/lib/i386-linux-gnu/libhpmud.so.0.0.6 30222
+usr/share/zoneinfo/Libya 30221
+usr/share/zoneinfo/Africa/Tunis 30220
+usr/share/zoneinfo/Africa/Windhoek 30219
+usr/share/zoneinfo/US/Aleutian 30218
+usr/share/zoneinfo/US/Alaska 30217
+usr/share/zoneinfo/America/Marigot 30216
+usr/share/zoneinfo/America/Araguaina 30215
+usr/share/zoneinfo/America/Buenos_Aires 30214
+usr/share/zoneinfo/America/Catamarca 30213
+usr/share/zoneinfo/America/Cordoba 30212
+usr/share/zoneinfo/America/Jujuy 30211
+usr/share/zoneinfo/America/Argentina/La_Rioja 30210
+usr/share/zoneinfo/America/Mendoza 30209
+usr/share/zoneinfo/America/Argentina/Rio_Gallegos 30208
+usr/share/zoneinfo/America/Argentina/Salta 30207
+usr/share/zoneinfo/America/Argentina/San_Juan 30206
+usr/share/zoneinfo/America/Argentina/San_Luis 30205
+usr/share/zoneinfo/America/Argentina/Tucuman 30204
+usr/share/zoneinfo/America/Argentina/Ushuaia 30203
+usr/share/zoneinfo/America/Curacao 30202
+usr/share/zoneinfo/America/Asuncion 30201
+usr/share/zoneinfo/America/Atikokan 30200
+usr/share/zoneinfo/America/Bahia 30199
+usr/share/zoneinfo/America/Bahia_Banderas 30198
+usr/share/zoneinfo/America/Barbados 30197
+usr/share/zoneinfo/America/Belem 30196
+usr/share/zoneinfo/America/Belize 30195
+usr/share/zoneinfo/America/Blanc-Sablon 30194
+usr/share/zoneinfo/America/Boa_Vista 30193
+usr/share/zoneinfo/America/Bogota 30192
+usr/share/zoneinfo/America/Boise 30191
+usr/share/zoneinfo/America/Cambridge_Bay 30190
+usr/share/zoneinfo/America/Campo_Grande 30189
+usr/share/zoneinfo/America/Cancun 30188
+usr/share/zoneinfo/America/Caracas 30187
+usr/share/zoneinfo/America/Cayenne 30186
+usr/share/zoneinfo/America/Panama 30185
+usr/share/zoneinfo/US/Central 30184
+usr/share/zoneinfo/America/Chihuahua 30183
+usr/share/zoneinfo/America/Costa_Rica 30182
+usr/share/zoneinfo/America/Creston 30181
+usr/share/zoneinfo/America/Cuiaba 30180
+usr/share/zoneinfo/America/Danmarkshavn 30179
+usr/lib/i386-linux-gnu/libcups.so.2 30178
+usr/share/zoneinfo/America/Dawson 30177
+usr/share/zoneinfo/America/Dawson_Creek 30176
+usr/share/zoneinfo/Navajo 30175
+usr/share/zoneinfo/US/Michigan 30174
+usr/share/zoneinfo/America/Edmonton 30173
+usr/share/zoneinfo/America/Eirunepe 30172
+usr/share/zoneinfo/America/El_Salvador 30171
+usr/share/zoneinfo/Mexico/BajaNorte 30170
+usr/share/zoneinfo/America/Fort_Nelson 30169
+usr/share/zoneinfo/US/East-Indiana 30168
+usr/share/zoneinfo/America/Fortaleza 30167
+usr/share/zoneinfo/America/Glace_Bay 30166
+usr/share/zoneinfo/America/Godthab 30165
+usr/share/zoneinfo/America/Goose_Bay 30164
+usr/share/zoneinfo/America/Grand_Turk 30163
+usr/share/zoneinfo/America/Guatemala 30162
+usr/share/zoneinfo/America/Guayaquil 30161
+usr/share/zoneinfo/America/Guyana 30160
+usr/share/zoneinfo/America/Halifax 30159
+usr/share/zoneinfo/Cuba 30158
+usr/share/zoneinfo/America/Hermosillo 30157
+usr/share/zoneinfo/US/Indiana-Starke 30156
+usr/share/zoneinfo/America/Indiana/Marengo 30155
+usr/share/zoneinfo/America/Indiana/Petersburg 30154
+usr/share/zoneinfo/America/Indiana/Tell_City 30153
+usr/share/zoneinfo/America/Indiana/Vevay 30152
+usr/share/zoneinfo/America/Indiana/Vincennes 30151
+usr/share/zoneinfo/America/Indiana/Winamac 30150
+usr/share/zoneinfo/America/Inuvik 30149
+usr/share/zoneinfo/America/Iqaluit 30148
+usr/share/zoneinfo/Jamaica 30147
+usr/share/zoneinfo/America/Juneau 30146
+usr/share/zoneinfo/America/Louisville 30145
+usr/share/zoneinfo/America/Kentucky/Monticello 30144
+usr/share/zoneinfo/America/La_Paz 30143
+usr/share/zoneinfo/America/Lima 30142
+usr/lib/i386-linux-gnu/libhpdiscovery.so.0.0.1 30141
+usr/lib/i386-linux-gnu/libnetsnmp.so.30.0.2 30140
+usr/share/zoneinfo/US/Pacific 30139
+usr/share/zoneinfo/America/Maceio 30138
+usr/share/zoneinfo/America/Managua 30137
+usr/share/zoneinfo/Brazil/West 30136
+usr/share/zoneinfo/America/Martinique 30135
+usr/share/zoneinfo/America/Matamoros 30134
+usr/share/zoneinfo/Mexico/BajaSur 30133
+usr/share/zoneinfo/America/Menominee 30132
+usr/share/zoneinfo/America/Merida 30131
+usr/share/zoneinfo/America/Metlakatla 30130
+usr/share/zoneinfo/Mexico/General 30129
+usr/share/zoneinfo/America/Miquelon 30128
+usr/share/zoneinfo/America/Moncton 30127
+usr/share/zoneinfo/America/Monterrey 30126
+usr/share/zoneinfo/America/Montevideo 30125
+usr/share/zoneinfo/America/Toronto 30124
+usr/share/zoneinfo/America/Nassau 30123
+usr/share/zoneinfo/posixrules 30122
+usr/share/zoneinfo/America/Nipigon 30121
+usr/share/zoneinfo/America/Nome 30120
+usr/share/zoneinfo/Brazil/DeNoronha 30119
+usr/share/zoneinfo/America/North_Dakota/Beulah 30118
+usr/share/zoneinfo/America/North_Dakota/Center 30117
+usr/share/zoneinfo/America/North_Dakota/New_Salem 30116
+usr/share/zoneinfo/America/Ojinaga 30115
+usr/share/zoneinfo/America/Pangnirtung 30114
+usr/share/zoneinfo/America/Paramaribo 30113
+usr/share/zoneinfo/US/Arizona 30112
+usr/share/zoneinfo/America/Port-au-Prince 30111
+usr/share/zoneinfo/Brazil/Acre 30110
+usr/share/zoneinfo/America/Porto_Velho 30109
+usr/share/zoneinfo/America/Puerto_Rico 30108
+usr/share/zoneinfo/America/Rainy_River 30107
+usr/share/zoneinfo/America/Rankin_Inlet 30106
+usr/share/zoneinfo/America/Recife 30105
+usr/share/zoneinfo/America/Regina 30104
+usr/share/zoneinfo/America/Resolute 30103
+usr/share/zoneinfo/America/Santarem 30102
+usr/share/zoneinfo/America/Santiago 30101
+usr/share/zoneinfo/America/Santo_Domingo 30100
+usr/share/zoneinfo/Brazil/East 30099
+usr/share/zoneinfo/America/Scoresbysund 30098
+usr/share/zoneinfo/America/Sitka 30097
+usr/share/zoneinfo/America/St_Johns 30096
+usr/share/zoneinfo/America/Swift_Current 30095
+usr/share/zoneinfo/America/Tegucigalpa 30094
+usr/share/zoneinfo/America/Thule 30093
+usr/share/zoneinfo/America/Thunder_Bay 30092
+usr/share/zoneinfo/America/Vancouver 30091
+usr/share/zoneinfo/America/Whitehorse 30090
+usr/share/zoneinfo/America/Winnipeg 30089
+usr/share/zoneinfo/America/Yakutat 30088
+usr/share/zoneinfo/America/Yellowknife 30087
+usr/share/zoneinfo/Antarctica/Casey 30086
+usr/share/zoneinfo/Antarctica/Davis 30085
+usr/share/zoneinfo/Antarctica/DumontDUrville 30084
+usr/share/zoneinfo/Antarctica/Macquarie 30083
+usr/share/zoneinfo/Antarctica/Mawson 30082
+usr/share/zoneinfo/NZ 30081
+usr/share/zoneinfo/Antarctica/Palmer 30080
+usr/share/zoneinfo/Antarctica/Rothera 30079
+usr/share/zoneinfo/Antarctica/Syowa 30078
+usr/share/zoneinfo/Antarctica/Troll 30077
+usr/share/zoneinfo/Antarctica/Vostok 30076
+usr/share/zoneinfo/Europe/Oslo 30075
+usr/share/zoneinfo/Asia/Aden 30074
+usr/share/zoneinfo/Asia/Almaty 30073
+usr/share/zoneinfo/Asia/Amman 30072
+usr/share/zoneinfo/Asia/Anadyr 30071
+usr/share/zoneinfo/Asia/Aqtau 30070
+usr/share/zoneinfo/Asia/Aqtobe 30069
+usr/share/zoneinfo/Asia/Ashgabat 30068
+usr/share/zoneinfo/Asia/Atyrau 30067
+usr/lib/i386-linux-gnu/libgssapi_krb5.so.2.2 30066
+usr/share/zoneinfo/Asia/Baghdad 30065
+usr/share/zoneinfo/Asia/Qatar 30064
+usr/share/zoneinfo/Asia/Baku 30063
+usr/share/zoneinfo/Asia/Bangkok 30062
+usr/share/zoneinfo/Asia/Barnaul 30061
+usr/share/zoneinfo/Asia/Beirut 30060
+usr/share/zoneinfo/Asia/Bishkek 30059
+usr/share/zoneinfo/Asia/Brunei 30058
+usr/share/zoneinfo/Asia/Kolkata 30057
+usr/share/zoneinfo/Asia/Chita 30056
+usr/share/zoneinfo/Asia/Choibalsan 30055
+usr/share/zoneinfo/PRC 30054
+usr/share/zoneinfo/Asia/Colombo 30053
+usr/share/zoneinfo/Asia/Dacca 30052
+usr/share/zoneinfo/Asia/Damascus 30051
+usr/share/zoneinfo/Asia/Dili 30050
+usr/share/zoneinfo/Asia/Muscat 30049
+usr/share/zoneinfo/Asia/Dushanbe 30048
+usr/share/zoneinfo/Asia/Famagusta 30047
+usr/share/zoneinfo/Asia/Gaza 30046
+usr/share/zoneinfo/Asia/Hebron 30045
+usr/share/zoneinfo/Asia/Saigon 30044
+usr/share/zoneinfo/Hongkong 30043
+usr/share/zoneinfo/Asia/Hovd 30042
+usr/share/zoneinfo/Asia/Irkutsk 30041
+usr/share/zoneinfo/Turkey 30040
+usr/share/zoneinfo/Asia/Jakarta 30039
+usr/share/zoneinfo/Asia/Jayapura 30038
+usr/share/zoneinfo/Israel 30037
+usr/share/zoneinfo/Asia/Kabul 30036
+usr/share/zoneinfo/Asia/Kamchatka 30035
+usr/share/zoneinfo/Asia/Karachi 30034
+usr/share/zoneinfo/Asia/Urumqi 30033
+usr/share/zoneinfo/Asia/Kathmandu 30032
+usr/share/zoneinfo/Asia/Khandyga 30031
+usr/share/zoneinfo/Asia/Krasnoyarsk 30030
+usr/share/zoneinfo/Asia/Kuala_Lumpur 30029
+usr/share/zoneinfo/Asia/Kuching 30028
+usr/share/zoneinfo/Asia/Macao 30027
+usr/share/zoneinfo/Asia/Magadan 30026
+usr/share/zoneinfo/Asia/Makassar 30025
+usr/share/zoneinfo/Asia/Manila 30024
+usr/share/zoneinfo/Europe/Nicosia 30023
+usr/share/zoneinfo/Asia/Novokuznetsk 30022
+usr/share/zoneinfo/Asia/Novosibirsk 30021
+usr/share/zoneinfo/Asia/Omsk 30020
+usr/share/zoneinfo/Asia/Oral 30019
+usr/share/zoneinfo/Asia/Pontianak 30018
+usr/share/zoneinfo/Asia/Pyongyang 30017
+usr/share/zoneinfo/Asia/Qyzylorda 30016
+usr/share/zoneinfo/Asia/Rangoon 30015
+usr/share/zoneinfo/Asia/Sakhalin 30014
+usr/share/zoneinfo/Asia/Samarkand 30013
+usr/share/zoneinfo/ROK 30012
+usr/share/zoneinfo/Singapore 30011
+usr/share/zoneinfo/Asia/Srednekolymsk 30010
+usr/share/zoneinfo/ROC 30009
+usr/share/zoneinfo/Asia/Tashkent 30008
+usr/share/zoneinfo/Asia/Tbilisi 30007
+usr/share/zoneinfo/Iran 30006
+usr/share/zoneinfo/Asia/Thimbu 30005
+usr/share/zoneinfo/Japan 30004
+usr/share/zoneinfo/Asia/Tomsk 30003
+usr/share/zoneinfo/Asia/Ulan_Bator 30002
+usr/share/zoneinfo/Asia/Ust-Nera 30001
+usr/share/zoneinfo/Asia/Vladivostok 30000
+usr/share/zoneinfo/Asia/Yakutsk 29999
+usr/share/zoneinfo/Asia/Yekaterinburg 29998
+usr/share/zoneinfo/Asia/Yerevan 29997
+usr/share/zoneinfo/Atlantic/Azores 29996
+usr/share/zoneinfo/Atlantic/Bermuda 29995
+usr/share/zoneinfo/Atlantic/Canary 29994
+usr/share/zoneinfo/Atlantic/Cape_Verde 29993
+usr/share/zoneinfo/Atlantic/Faroe 29992
+usr/share/zoneinfo/Atlantic/Madeira 29991
+usr/share/zoneinfo/Iceland 29990
+usr/share/zoneinfo/Atlantic/South_Georgia 29989
+usr/share/zoneinfo/Atlantic/Stanley 29988
+usr/share/zoneinfo/Australia/Canberra 29987
+usr/share/zoneinfo/Australia/Adelaide 29986
+usr/share/zoneinfo/Australia/Queensland 29985
+usr/share/zoneinfo/Australia/Broken_Hill 29984
+usr/share/zoneinfo/Australia/Currie 29983
+usr/share/zoneinfo/Australia/North 29982
+usr/lib/i386-linux-gnu/libkrb5.so.3.3 29981
+usr/share/zoneinfo/Australia/Eucla 29980
+usr/share/zoneinfo/Australia/Tasmania 29979
+usr/share/zoneinfo/Australia/LHI 29978
+usr/share/zoneinfo/Australia/Lindeman 29977
+usr/share/zoneinfo/Australia/Melbourne 29976
+usr/share/zoneinfo/Australia/Perth 29975
+usr/share/zoneinfo/CET 29974
+usr/share/zoneinfo/CST6CDT 29973
+usr/lib/i386-linux-gnu/libk5crypto.so.3.1 29972
+usr/share/zoneinfo/Pacific/Easter 29971
+usr/share/zoneinfo/EET 29970
+usr/share/zoneinfo/EST 29969
+usr/share/zoneinfo/EST5EDT 29968
+usr/share/zoneinfo/Eire 29967
+usr/share/zoneinfo/GMT-0 29966
+usr/share/zoneinfo/Etc/GMT+1 29965
+usr/share/zoneinfo/Etc/GMT+10 29964
+usr/share/zoneinfo/Etc/GMT+11 29963
+usr/share/zoneinfo/Etc/GMT+12 29962
+usr/share/zoneinfo/Etc/GMT+2 29961
+usr/share/zoneinfo/Etc/GMT+3 29960
+usr/share/zoneinfo/Etc/GMT+4 29959
+usr/share/zoneinfo/Etc/GMT+5 29958
+usr/share/zoneinfo/Etc/GMT+6 29957
+usr/share/zoneinfo/Etc/GMT+7 29956
+usr/share/zoneinfo/Etc/GMT+8 29955
+usr/share/zoneinfo/Etc/GMT+9 29954
+usr/share/zoneinfo/Etc/GMT-1 29953
+usr/share/zoneinfo/Etc/GMT-10 29952
+usr/share/zoneinfo/Etc/GMT-11 29951
+usr/share/zoneinfo/Etc/GMT-12 29950
+usr/share/zoneinfo/Etc/GMT-13 29949
+usr/share/zoneinfo/Etc/GMT-14 29948
+usr/share/zoneinfo/Etc/GMT-2 29947
+usr/share/zoneinfo/Etc/GMT-3 29946
+usr/share/zoneinfo/Etc/GMT-4 29945
+usr/share/zoneinfo/Etc/GMT-5 29944
+usr/share/zoneinfo/Etc/GMT-6 29943
+usr/share/zoneinfo/Etc/GMT-7 29942
+usr/share/zoneinfo/Etc/GMT-8 29941
+usr/share/zoneinfo/Etc/GMT-9 29940
+usr/share/zoneinfo/UCT 29939
+lib/i386-linux-gnu/libcom_err.so.2.1 29938
+usr/lib/i386-linux-gnu/libkrb5support.so.0.1 29937
+lib/i386-linux-gnu/libkeyutils.so.1.5 29936
+usr/lib/python2.7/dist-packages/gi/overrides/Gdk.py 29935
+usr/lib/i386-linux-gnu/girepository-1.0/GdkX11-3.0.typelib 29934
+usr/lib/girepository-1.0/Xkl-1.0.typelib 29933
+usr/lib/girepository-1.0/AccountsService-1.0.typelib 29932
+usr/share/tails-greeter/default_langcodes 29931
+usr/share/tails-greeter/language_codes 29930
+usr/lib/libxklavier.so.16.2.0 29929
+usr/share/X11/xkb/rules/evdev.lst 29928
+usr/share/X11/xkb/rules/evdev.xml 29927
+usr/lib/python2.7/dist-packages/tailsgreeter/langpanel.py 29926
+usr/lib/python2.7/dist-packages/tailsgreeter/persistencewindow.py 29925
+usr/lib/python2.7/dist-packages/tailsgreeter/helpwindow.py 29924
+usr/lib/python2.7/webbrowser.py 29923
+usr/lib/python2.7/shlex.py 29922
+usr/lib/i386-linux-gnu/girepository-1.0/WebKit-3.0.typelib 29921
+usr/lib/girepository-1.0/Soup-2.4.typelib 29920
+usr/lib/i386-linux-gnu/girepository-1.0/JavaScriptCore-3.0.typelib 29919
+usr/lib/python2.7/dist-packages/tailsgreeter/optionswindow.py 29918
+usr/lib/i386-linux-gnu/libgdm.so.1.0.0 29917
+usr/lib/python2.7/dist-packages/gi/overrides/Gio.py 29916
+usr/share/tails-greeter/glade/langpanel.glade 29915
+usr/share/locale/en/LC_MESSAGES/tails-greeter.mo 29914
+usr/share/icons/Adwaita/16x16/categories/applications-internet.png 29913
+usr/share/fonts/truetype/dejavu/DejaVuSans.ttf 29912
+usr/share/fonts/truetype/unfonts-core/UnDotum.ttf 29911
+usr/share/icons/Adwaita/scalable/actions/pan-down-symbolic.svg 29910
+usr/lib/i386-linux-gnu/gdk-pixbuf-2.0/2.10.0/loaders/libpixbufloader-svg.so 29909
+usr/lib/i386-linux-gnu/librsvg-2.so.2.40.5 29908
+usr/lib/i386-linux-gnu/libcroco-0.6.so.3.0.1 29907
+usr/share/icons/Adwaita/16x16/apps/preferences-desktop-locale.png 29906
+usr/share/icons/Adwaita/16x16/apps/preferences-desktop-keyboard.png 29905
+usr/share/tails-greeter/glade/persistencewindow.glade 29904
+usr/local/sbin/live-persist 29903
+lib/live/boot/9990-cmdline-old 29902
+lib/live/boot/9990-misc-helpers.sh 29901
+sbin/cryptsetup 29899
+lib/i386-linux-gnu/libcryptsetup.so.4.6.0 29898
+lib/i386-linux-gnu/libpopt.so.0.0.0 29897
+usr/share/tails-greeter/glade/optionswindow.glade 29896
+usr/lib/i386-linux-gnu/gtk-3.0/3.0.0/immodules.cache 29895
+usr/lib/i386-linux-gnu/gtk-3.0/3.0.0/immodules/im-ibus.so 29894
+usr/lib/i386-linux-gnu/libibus-1.0.so.5.0.509 29893
+usr/share/icons/Adwaita/16x16/status/dialog-warning.png 29892
+usr/share/fonts/opentype/cantarell/Cantarell-Bold.otf 29891
+usr/lib/i386-linux-gnu/gconv/ISO8859-1.so 29890
+usr/share/icons/Adwaita/256x256/status/image-missing.png 29889
+usr/share/icons/Adwaita/16x16/status/image-missing.png 29888
+usr/share/icons/Adwaita/cursors/watch 29887
+etc/pam.d/gdm-password 29886
+lib/i386-linux-gnu/security/pam_succeed_if.so 29885
+lib/i386-linux-gnu/security/pam_selinux.so 29884
+lib/i386-linux-gnu/security/pam_loginuid.so 29883
+etc/gdm3/PostLogin/Default 29882
+etc/live/config.d/username.conf 29881
+usr/local/lib/tails-unblock-network 29880
+usr/bin/localectl 29879
+lib/systemd/system/tails-unblock-network.service 29878
+bin/sync 29877
+usr/local/sbin/tails-additional-software 29876
+usr/bin/env 29875
+usr/lib/python2.7/encodings/ascii.py 29874
+usr/sbin/deluser 29873
+usr/share/perl/5.20.2/File/Find.pm 29872
+usr/share/perl/5.20.2/File/Basename.pm 29871
+usr/share/perl/5.20.2/File/Temp.pm 29870
+usr/share/perl/5.20.2/File/Path.pm 29869
+usr/lib/i386-linux-gnu/perl/5.20.2/Errno.pm 29868
+usr/share/perl/5.20.2/parent.pm 29867
+usr/share/perl/5.20.2/Carp/Heavy.pm 29866
+etc/deluser.conf 29865
+usr/bin/passwd 29864
+usr/local/lib/tails-shell-library/tails-greeter.sh 29860
+etc/gdm3/PreSession/Default 29859
+etc/gdm3/Xsession 29858
+etc/profile 29857
+etc/profile.d/bash_completion.sh 29856
+etc/profile.d/vte-2.91.sh 29855
+etc/profile.d/vte.sh 29854
+etc/X11/Xsession.d/20x11-common_process-args 29853
+etc/X11/Xsession.options 29852
+etc/X11/Xsession.d/30x11-common_xresources 29851
+usr/bin/xrdb 29850
+usr/lib/i386-linux-gnu/libXmuu.so.1.0.0 29849
+etc/X11/Xresources/x11-common 29848
+usr/bin/cpp-4.9 29847
+usr/lib/gcc/i586-linux-gnu/4.9/cc1 29846
+usr/lib/i386-linux-gnu/libcloog-isl.so.4.0.0 29845
+usr/lib/i386-linux-gnu/libisl.so.10.2.2 29844
+usr/lib/i386-linux-gnu/libmpc.so.3.0.0 29843
+usr/lib/i386-linux-gnu/libmpfr.so.4.1.2 29842
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/drivers/net/virtio_net.ko 29834
+usr/local/lib/tails-spoof-mac 29819
+usr/local/lib/tails-shell-library/hardware.sh 29818
+usr/local/lib/tails-shell-library/log.sh 29817
+usr/bin/gettext.sh 29816
+usr/bin/macchanger 29815
+usr/share/macchanger/OUI.list 29814
+usr/share/macchanger/wireless.list 29813
+lib/systemd/systemd-sysctl 29812
+etc/sysctl.d/kptr_restrict.conf 29811
+etc/sysctl.d/pmtud.conf 29810
+etc/sysctl.d/ptrace_scope.conf 29809
+etc/sysctl.d/tcp_timestamps.conf 29808
+etc/sysctl.d/unprivileged_bpf.conf 29807
+lib/systemd/system/NetworkManager.service 29805
+lib/systemd/system/NetworkManager-wait-online.service 29804
+lib/systemd/system/NetworkManager-dispatcher.service 29803
+run/systemd/#33511 29802
+lib/systemd/system-generators/systemd-system-update-generator 29801
+lib/systemd/system-generators/systemd-insserv-generator 29800
+lib/systemd/system-generators/tor-generator 29799
+lib/systemd/system-generators/systemd-rc-local-generator 29798
+lib/systemd/system-generators/systemd-sysv-generator 29797
+etc/init.d/apparmor 29796
+lib/systemd/system-generators/systemd-gpt-auto-generator 29795
+etc/init.d/gdomap 29794
+etc/init.d/hdparm 29793
+etc/insserv.conf.d/gdm3 29792
+lib/systemd/system-generators/systemd-fstab-generator 29791
+lib/systemd/system-generators/systemd-getty-generator 29790
+lib/systemd/system-generators/systemd-debug-generator 29789
+lib/systemd/system-generators/systemd-default-display-manager-generator 29788
+lib/systemd/system-generators/systemd-cryptsetup-generator 29787
+etc/insserv.conf 29786
+etc/init.d/rc 29785
+etc/init.d/rcS 29784
+etc/init.d/ttdnsd 29783
+etc/crypttab 29782
+lib/systemd/system/sys-fs-fuse-connections.mount 29781
+lib/systemd/system/system.slice 29780
+lib/systemd/system/-.slice 29779
+lib/systemd/system/slices.target 29778
+lib/systemd/system/systemd-journald.socket 29777
+lib/systemd/system/systemd-journald.service 29776
+lib/systemd/system/syslog.socket 29775
+lib/systemd/system/systemd-setup-dgram-qlen.service 29774
+lib/systemd/system/systemd-journald-dev-log.socket 29773
+lib/systemd/system/systemd-udevd-kernel.socket 29772
+lib/systemd/system/systemd-udevd.service 29771
+lib/systemd/system/systemd-udevd-control.socket 29770
+lib/systemd/system/systemd-shutdownd.socket 29769
+lib/systemd/system/systemd-shutdownd.service 29768
+lib/systemd/system/systemd-initctl.socket 29767
+lib/systemd/system/systemd-initctl.service 29766
+lib/systemd/system/dbus.socket 29765
+lib/systemd/system/dbus.service 29764
+lib/systemd/system/basic.target 29763
+lib/systemd/system/live-config.service 29762
+lib/systemd/system/systemd-tmpfiles-clean.timer 29761
+lib/systemd/system/systemd-tmpfiles-clean.service 29760
+lib/systemd/system/time-sync.target 29759
+lib/systemd/system/local-fs.target 29758
+lib/systemd/system/systemd-remount-fs.service 29757
+lib/systemd/system/systemd-fsck-root.service 29756
+lib/systemd/system/umount.target 29755
+lib/systemd/system/lvm2-activation.service 29754
+lib/systemd/system/systemd-udev-settle.service 29753
+lib/systemd/system/systemd-udev-trigger.service 29752
+lib/systemd/system/cryptsetup.target 29751
+lib/systemd/system/lvm2-activation-early.service 29750
+lib/systemd/system/emergency.target 29749
+lib/systemd/system/emergency.service 29748
+lib/systemd/system/rescue.service 29747
+lib/systemd/system/plymouth-start.service 29746
+lib/systemd/system/systemd-ask-password-plymouth.service 29745
+lib/systemd/system/systemd-ask-password-plymouth.path 29744
+lib/systemd/system/local-fs-pre.target 29743
+lib/systemd/system/systemd-readahead-replay.service 29742
+lib/systemd/system/systemd-readahead-collect.service 29741
+lib/systemd/system/systemd-readahead-done.timer 29740
+lib/systemd/system/systemd-readahead-done.service 29739
+lib/systemd/system/graphical.target 29738
+lib/systemd/system/systemd-update-utmp-runlevel.service 29737
+lib/systemd/system/remote-fs.target 29736
+lib/systemd/system/remote-fs-pre.target 29735
+lib/systemd/system/multi-user.target 29734
+lib/systemd/system/systemd-user-sessions.service 29733
+lib/systemd/system/network.target 29732
+lib/systemd/system/network-pre.target 29731
+lib/systemd/system/nss-user-lookup.target 29730
+lib/systemd/system/user.slice 29729
+lib/systemd/system/systemd-ask-password-wall.path 29728
+lib/systemd/system/systemd-ask-password-wall.service 29727
+lib/systemd/system/plymouth-quit.service 29726
+lib/systemd/system/plymouth-quit-wait.service 29725
+lib/systemd/system/getty.target 29724
+lib/systemd/system/getty-static.service 29723
+lib/systemd/system/getty@.service 29722
+lib/systemd/system/rc-local.service 29721
+lib/systemd/system/tor-controlport-filter.service 29720
+lib/systemd/system/tails-set-wireless-devices-state.service 29719
+lib/systemd/system/tails-sdmem-on-media-removal.service 29718
+lib/systemd/system/tails-reconfigure-memlockd.service 29717
+lib/systemd/system/tails-reconfigure-kexec.service 29716
+lib/systemd/system/tails-autotest-remote-shell.service 29715
+lib/systemd/system/gdm.service 29714
+lib/systemd/system/gdm.service.d/restart.conf 29713
+lib/systemd/system/pppd-dns.service 29712
+lib/systemd/system/open-vm-tools.service 29711
+lib/systemd/system/memlockd.service 29710
+lib/systemd/system/memlockd.service.d/oom.conf 29709
+lib/systemd/system/cron.service 29708
+lib/systemd/system/ModemManager.service 29707
+lib/systemd/system/rescue.target 29706
+lib/systemd/system/systemd-update-utmp.service 29705
+lib/systemd/system/systemd-tmpfiles-setup.service 29704
+lib/systemd/system/tails-tor-has-bootstrapped.target 29703
+lib/systemd/system/tails-wait-until-tor-has-bootstrapped.service 29702
+lib/systemd/system/tor@default.service 29701
+lib/systemd/system/tor@default.service.d/fix-obfs4proxy.conf 29700
+lib/systemd/system/tor@default.service.d/writable-etc-tor.conf 29699
+lib/systemd/system/tor.service 29698
+lib/systemd/system/nss-lookup.target 29697
+lib/systemd/system/tails-tor-has-bootstrapped-flag-file.service 29696
+lib/systemd/system/accounts-daemon.service 29695
+lib/systemd/system/haveged.service 29694
+lib/systemd/system/pcscd.socket 29693
+lib/systemd/system/pcscd.service 29692
+lib/systemd/system/dm-event.socket 29691
+lib/systemd/system/dm-event.service 29690
+lib/systemd/system/cups.socket 29689
+lib/systemd/system/cups.service 29688
+lib/systemd/system/cups.service.d/after-AppArmor.conf 29687
+lib/systemd/system/sysinit.target 29686
+lib/systemd/system/network-online.target 29685
+lib/systemd/system/networking.service.d/network-pre.conf 29684
+lib/systemd/system/systemd-random-seed.service 29683
+lib/systemd/system/udev-finish.service 29682
+lib/systemd/system/systemd-tmpfiles-setup-dev.service 29681
+lib/systemd/system/systemd-sysctl.service 29680
+lib/systemd/system/systemd-journal-flush.service 29679
+lib/systemd/system/systemd-binfmt.service 29678
+lib/systemd/system/systemd-ask-password-console.path 29677
+lib/systemd/system/systemd-ask-password-console.service 29676
+lib/systemd/system/sys-kernel-debug.mount 29675
+lib/systemd/system/sys-kernel-config.mount 29674
+lib/systemd/system/proc-sys-fs-binfmt_misc.automount 29673
+lib/systemd/system/proc-sys-fs-binfmt_misc.mount 29672
+lib/systemd/system/plymouth-read-write.service 29671
+lib/systemd/system/kmod-static-nodes.service 29670
+lib/systemd/system/dev-mqueue.mount 29669
+lib/systemd/system/dev-hugepages.mount 29668
+lib/systemd/system/debian-fixup.service 29667
+lib/systemd/system/lvm2-monitor.service 29666
+lib/systemd/system/lvm2-lvmetad.service 29665
+lib/systemd/system/lvm2-lvmetad.socket 29664
+lib/systemd/system/swap.target 29663
+lib/systemd/system/systemd-modules-load.service 29662
+usr/sbin/NetworkManager 29661
+usr/lib/NetworkManager/nm-dispatcher 29660
+usr/lib/i386-linux-gnu/libnm-util.so.2.6.0 29659
+usr/lib/i386-linux-gnu/libnl-route-3.so.200.19.0 29658
+lib/i386-linux-gnu/libnl-genl-3.so.200.19.0 29657
+lib/i386-linux-gnu/libnl-3.so.200.19.0 29656
+usr/lib/i386-linux-gnu/libsoup-2.4.so.1.7.0 29655
+usr/lib/i386-linux-gnu/libteamdctl.so.0.1.1 29654
+usr/lib/i386-linux-gnu/libndp.so.0.0.2 29653
+etc/libnl-3/classid 29652
+etc/X11/Xsession.d/35x11-common_xhost-local 29651
+usr/bin/xhost 29650
+etc/X11/Xsession.d/40x11-common_xsessionrc 29649
+etc/amnesia/environment 29648
+etc/X11/Xsession.d/50x11-common_determine-startup 29647
+etc/X11/Xsession.d/55gnome-session_gnomerc 29646
+etc/X11/Xsession.d/56gnome-classic 29645
+usr/bin/whoami 29644
+etc/X11/Xsession.d/60xdg-user-dirs-update 29643
+usr/bin/xdg-user-dirs-update 29642
+etc/xdg/user-dirs.conf 29641
+etc/xdg/user-dirs.defaults 29640
+etc/X11/Xsession.d/70monkeysphere_use-validation-agent 29639
+etc/monkeysphere/monkeysphere.conf 29638
+etc/X11/Xsession.d/75dbus_dbus-launch 29637
+etc/X11/Xsession.d/90gpg-agent 29636
+usr/bin/gpg-agent 29635
+usr/lib/i386-linux-gnu/libassuan.so.0.4.2 29634
+usr/lib/i386-linux-gnu/libpth.so.20.0.27 29633
+etc/NetworkManager/NetworkManager.conf 29632
+etc/NetworkManager/conf.d/dhcp-hostname.conf 29631
+etc/NetworkManager/conf.d/dns.conf 29630
+etc/NetworkManager/conf.d/plugins.conf 29629
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/rfkill/rfkill.ko 29628
+etc/X11/Xsession.d/90qt-a11y 29627
+etc/X11/Xsession.d/90x11-common_ssh-agent 29626
+etc/X11/Xsession.d/98vboxadd-xclient 29625
+usr/bin/notify-send 29624
+etc/X11/Xsession.d/99x11-common_start 29623
+usr/bin/msva-perl 29622
+usr/share/perl5/Crypt/Monkeysphere/MSVA.pm 29621
+lib/modules/4.8.0-0.bpo.2-amd64/kernel/net/wireless/cfg80211.ko 29620
+usr/share/perl5/HTTP/Server/Simple/CGI.pm 29618
+usr/share/perl5/HTTP/Server/Simple.pm 29617
+usr/lib/i386-linux-gnu/perl/5.20.2/Socket.pm 29616
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Socket/Socket.so 29615
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Select.pm 29614
+usr/share/perl5/HTTP/Server/Simple/CGI/Environment.pm 29613
+usr/share/perl5/Crypt/Monkeysphere/Validator.pm 29612
+usr/share/perl5/Crypt/Monkeysphere/Keyserver.pm 29611
+usr/share/perl5/GnuPG/Handles.pm 29610
+usr/share/perl5/Moo.pm 29609
+usr/share/perl5/strictures.pm 29608
+usr/share/perl5/Moo/_Utils.pm 29607
+usr/lib/i386-linux-gnu/perl5/5.20/Sub/Name.pm 29606
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Sub/Name/Name.so 29605
+usr/share/perl5/Module/Runtime.pm 29604
+usr/share/perl5/Devel/GlobalDestruction.pm 29603
+usr/share/perl5/Sub/Exporter/Progressive.pm 29602
+usr/share/perl5/Moo/_mro.pm 29601
+usr/lib/i386-linux-gnu/perl/5.20.2/mro.pm 29600
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/mro/mro.so 29599
+usr/share/perl5/Moo/HandleMoose/_TypeMap.pm 29598
+usr/share/perl5/Import/Into.pm 29597
+usr/share/perl5/Moo/sification.pm 29596
+usr/share/perl5/Moo/Object.pm 29595
+usr/share/perl5/MooX/late.pm 29594
+usr/share/perl5/Method/Generate/Constructor.pm 29593
+usr/share/perl5/Sub/Quote.pm 29592
+usr/share/perl5/Sub/Defer.pm 29591
+usr/lib/i386-linux-gnu/perl/5.20.2/B.pm 29590
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/B/B.so 29589
+sbin/crda 29588
+usr/share/perl5/Method/Generate/Accessor.pm 29587
+usr/share/perl5/Moo/Role.pm 29586
+usr/share/perl5/Role/Tiny.pm 29585
+usr/share/perl5/GnuPG/HashInit.pm 29584
+usr/share/perl5/Type/Utils.pm 29583
+lib/crda/libreg.so 29582
+usr/share/perl5/Type/Library.pm 29581
+usr/share/perl5/Eval/TypeTiny.pm 29580
+usr/share/perl5/Exporter/Tiny.pm 29579
+lib/crda/regulatory.bin 29578
+lib/crda/pubkeys/benh@debian.org.key.pub.pem 29577
+usr/share/perl5/Type/Tiny.pm 29576
+usr/share/perl5/Types/TypeTiny.pm 29575
+usr/share/perl5/Type/Registry.pm 29574
+usr/share/perl5/Type/Parser.pm 29573
+usr/share/perl/5.20.2/Text/Balanced.pm 29572
+usr/share/perl/5.20.2/SelfLoader.pm 29571
+usr/share/perl5/Types/Standard.pm 29570
+usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-adsl.so 29569
+usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-bluetooth.so 29568
+usr/share/perl5/Type/Coercion.pm 29567
+usr/share/perl5/GnuPG/Interface.pm 29566
+usr/share/perl/5.20.2/English.pm 29565
+usr/lib/i386-linux-gnu/perl/5.20.2/Tie/Hash/NamedCapture.pm 29564
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Tie/Hash/NamedCapture/NamedCapture.so 29563
+usr/share/perl/5.20.2/Fatal.pm 29562
+usr/lib/i386-linux-gnu/NetworkManager/libnm-wwan.so 29561
+usr/share/perl/5.20.2/Tie/RefHash.pm 29560
+usr/lib/i386-linux-gnu/perl/5.20.2/Config_heavy.pl 29559
+usr/lib/i386-linux-gnu/perl/5.20.2/Config_git.pl 29558
+usr/share/perl/5.20.2/Class/Struct.pm 29557
+usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-wifi.so 29556
+usr/lib/i386-linux-gnu/NetworkManager/libnm-device-plugin-wwan.so 29555
+usr/share/perl/5.20.2/Math/BigInt.pm 29554
+usr/bin/nm-online 29553
+usr/lib/i386-linux-gnu/libnm-glib.so.4.8.0 29552
+etc/dhcp/dhclient.conf 29551
+usr/share/perl/5.20.2/Math/BigInt/Calc.pm 29550
+sbin/dhclient 29549
+usr/share/perl/5.20.2/integer.pm 29548
+usr/share/perl5/GnuPG/Options.pm 29547
+usr/share/perl5/MooX/HandlesVia.pm 29546
+usr/share/perl5/Data/Perl/Collection/Array/MooseLike.pm 29545
+usr/share/perl5/Role/Tiny/With.pm 29544
+usr/share/perl5/Class/Method/Modifiers.pm 29543
+usr/share/perl5/Data/Perl/Role/Collection/Array.pm 29542
+usr/lib/i386-linux-gnu/perl5/5.20/List/MoreUtils.pm 29541
+usr/lib/i386-linux-gnu/perl5/5.20/auto/List/MoreUtils/MoreUtils.so 29540
+lib/i386-linux-gnu/libirs-export.so.91.0.0 29539
+usr/share/perl5/Type/Tiny/Class.pm 29538
+usr/share/perl5/File/HomeDir.pm 29537
+usr/share/perl5/File/Which.pm 29536
+lib/i386-linux-gnu/libdns-export.so.100.2.2 29535
+usr/share/perl5/File/HomeDir/FreeDesktop.pm 29534
+usr/share/perl5/File/HomeDir/Unix.pm 29533
+usr/share/perl5/File/HomeDir/Driver.pm 29532
+usr/share/perl5/Config/General.pm 29531
+usr/lib/i386-linux-gnu/perl/5.20.2/File/Spec/Functions.pm 29530
+usr/lib/i386-linux-gnu/perl/5.20.2/File/Glob.pm 29529
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/File/Glob/Glob.so 29528
+usr/share/perl5/Regexp/Common.pm 29527
+lib/i386-linux-gnu/libisc-export.so.95.5.0 29526
+usr/share/perl5/Regexp/Common/net.pm 29525
+lib/i386-linux-gnu/libisccfg-export.so.90.1.0 29524
+usr/share/perl5/Crypt/Monkeysphere/Logger.pm 29523
+usr/share/perl5/Crypt/Monkeysphere/Util.pm 29522
+usr/share/perl5/Crypt/X509.pm 29521
+usr/share/perl5/Convert/ASN1.pm 29520
+usr/share/perl5/Convert/ASN1/_decode.pm 29519
+usr/share/perl5/Convert/ASN1/_encode.pm 29518
+usr/share/perl5/Convert/ASN1/IO.pm 29517
+usr/share/perl5/Convert/ASN1/parser.pm 29516
+usr/lib/i386-linux-gnu/perl/5.20.2/MIME/Base64.pm 29515
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/MIME/Base64/Base64.so 29514
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket.pm 29513
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket/INET.pm 29512
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Socket/UNIX.pm 29511
+usr/share/perl5/Crypt/Monkeysphere/MSVA/MarginalUI.pm 29510
+usr/share/perl/5.20.2/Module/Load/Conditional.pm 29509
+usr/share/perl/5.20.2/Module/Load.pm 29508
+usr/share/perl/5.20.2/Params/Check.pm 29507
+usr/share/perl/5.20.2/Locale/Maketext/Simple.pm 29506
+usr/lib/NetworkManager/nm-dhcp-helper 29505
+usr/share/perl/5.20.2/version.pm 29504
+usr/share/perl/5.20.2/version/regex.pm 29503
+usr/share/perl/5.20.2/Module/Metadata.pm 29502
+usr/share/perl5/Crypt/Monkeysphere/MSVA/Monitor.pm 29500
+usr/share/perl5/Crypt/Monkeysphere/OpenPGP.pm 29499
+usr/lib/i386-linux-gnu/perl/5.20.2/Digest/SHA.pm 29498
+usr/share/perl/5.20.2/Digest/base.pm 29497
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Digest/SHA/SHA.so 29496
+usr/share/perl5/JSON.pm 29495
+usr/share/perl/5.20.2/JSON/PP.pm 29494
+usr/share/perl5/Method/Generate/BuildAll.pm 29493
+usr/share/perl5/Net/Server/MSVA.pm 29492
+usr/share/perl5/Net/Server/Fork.pm 29491
+usr/share/perl5/Net/Server.pm 29490
+usr/share/perl5/Net/Server/Proto.pm 29489
+usr/share/perl5/Net/Server/Daemonize.pm 29488
+usr/share/perl5/Net/Server/SIG.pm 29487
+usr/share/perl5/Net/Server/Proto/TCP.pm 29486
+usr/share/gnome-session/sessions/gnome-classic.session 29485
+usr/share/applications/gnome-shell-classic.desktop 29484
+usr/share/gnome/autostart/nautilus-autostart.desktop 29483
+etc/xdg/autostart/at-spi-dbus-bus.desktop 29482
+usr/share/applications/florence.desktop 29481
+usr/lib/gvfs/gvfsd 29480
+usr/lib/i386-linux-gnu/gvfs/libgvfsdaemon.so 29479
+usr/lib/i386-linux-gnu/libsecret-1.so.0.0.0 29478
+usr/share/gvfs/mounts/afc.mount 29477
+usr/share/gvfs/mounts/afp-browse.mount 29476
+usr/share/gvfs/mounts/afp.mount 29475
+usr/share/gvfs/mounts/archive.mount 29474
+usr/share/gvfs/mounts/burn.mount 29473
+usr/share/gvfs/mounts/cdda.mount 29472
+usr/share/gvfs/mounts/computer.mount 29471
+usr/share/gvfs/mounts/dav+sd.mount 29470
+usr/share/gvfs/mounts/dav.mount 29469
+usr/share/gvfs/mounts/dns-sd.mount 29468
+usr/share/gvfs/mounts/ftp.mount 29467
+usr/share/gvfs/mounts/gphoto2.mount 29466
+usr/share/gvfs/mounts/http.mount 29465
+usr/share/gvfs/mounts/localtest.mount 29464
+usr/share/gvfs/mounts/mtp.mount 29463
+usr/share/gvfs/mounts/network.mount 29462
+usr/share/gvfs/mounts/obexftp.mount 29461
+usr/share/gvfs/mounts/recent.mount 29460
+usr/share/gvfs/mounts/sftp.mount 29459
+usr/share/gvfs/mounts/smb-browse.mount 29458
+usr/share/gvfs/mounts/smb.mount 29457
+usr/share/gvfs/mounts/trash.mount 29456
+etc/xdg/autostart/gnome-keyring-gpg.desktop 29455
+etc/xdg/autostart/gnome-keyring-pkcs11.desktop 29454
+etc/xdg/autostart/gnome-keyring-secrets.desktop 29453
+etc/xdg/autostart/gnome-keyring-ssh.desktop 29452
+etc/xdg/autostart/gsettings-data-convert.desktop 29451
+etc/xdg/autostart/nm-applet.desktop 29450
+etc/xdg/autostart/notification-daemon.desktop 29449
+etc/xdg/autostart/openpgp-applet.desktop 29448
+etc/xdg/autostart/orca-autostart.desktop 29447
+etc/xdg/autostart/polkit-gnome-authentication-agent-1.desktop 29446
+etc/xdg/autostart/print-applet.desktop 29445
+etc/xdg/autostart/pulseaudio-kde.desktop 29444
+etc/xdg/autostart/pulseaudio.desktop 29443
+etc/xdg/autostart/systemd-desktop-target.desktop 29442
+usr/bin/gnome-keyring-daemon 29441
+usr/lib/i386-linux-gnu/libgcr-base-3.so.1.0.0 29440
+usr/lib/i386-linux-gnu/libgck-1.so.0.0.0 29439
+usr/bin/gsettings-data-convert 29438
+usr/share/GConf/gsettings/brasero.convert 29437
+usr/share/GConf/gsettings/eog.convert 29436
+usr/share/GConf/gsettings/evince.convert 29435
+usr/share/GConf/gsettings/evolution-data-server.convert 29434
+usr/share/GConf/gsettings/evolution.convert 29433
+usr/share/GConf/gsettings/file-roller.convert 29432
+usr/share/GConf/gsettings/gedit.convert 29431
+usr/share/GConf/gsettings/gnome-screenshot.convert 29430
+usr/bin/start-pulseaudio-x11 29429
+usr/share/GConf/gsettings/gnome-search-tool.convert 29428
+usr/share/GConf/gsettings/gnome-session.convert 29427
+usr/share/GConf/gsettings/gnome-settings-daemon.convert 29426
+usr/share/GConf/gsettings/gnome-shell-overrides.convert 29425
+usr/share/GConf/gsettings/gsettings-desktop-schemas.convert 29424
+usr/share/GConf/gsettings/gvfs-dns-sd.convert 29423
+usr/share/GConf/gsettings/gvfs-smb.convert 29422
+usr/share/GConf/gsettings/ibus.convert 29421
+usr/share/GConf/gsettings/libgnomekbd.convert 29420
+usr/share/GConf/gsettings/logview.convert 29419
+usr/share/GConf/gsettings/metacity-schemas.convert 29418
+usr/share/GConf/gsettings/mousetweaks.convert 29417
+usr/share/GConf/gsettings/mutter-schemas.convert 29416
+usr/share/GConf/gsettings/nautilus.convert 29415
+usr/share/GConf/gsettings/nm-applet.convert 29414
+usr/share/GConf/gsettings/opensubtitles.convert 29413
+usr/share/GConf/gsettings/org.gnome.crypto.cache.convert 29412
+usr/share/GConf/gsettings/org.gnome.crypto.pgp.convert 29411
+usr/share/GConf/gsettings/org.gnome.crypto.pgp_keyservers.convert 29410
+usr/share/GConf/gsettings/org.gnome.seahorse.convert 29409
+usr/share/GConf/gsettings/org.gnome.seahorse.manager.convert 29408
+usr/share/GConf/gsettings/org.gnome.seahorse.nautilus.convert 29407
+usr/share/GConf/gsettings/org.gnome.seahorse.recipients.convert 29406
+usr/share/GConf/gsettings/pythonconsole.convert 29405
+usr/share/GConf/gsettings/sound-juicer.convert 29404
+usr/share/GConf/gsettings/totem.convert 29403
+usr/share/GConf/gsettings/wm-schemas.convert 29402
+usr/lib/gnome-settings-daemon-3.0/libhousekeeping.so 29401
+usr/lib/gnome-settings-daemon-3.0/libgsdwacom.so 29400
+usr/lib/gnome-settings-daemon-3.0/libmouse.so 29399
+usr/lib/gnome-settings-daemon-3.0/libscreensaver-proxy.so 29398
+usr/lib/gnome-settings-daemon-3.0/libsharing.so 29397
+usr/lib/gnome-settings-daemon-3.0/librfkill.so 29396
+usr/lib/gnome-settings-daemon-3.0/libprint-notifications.so 29395
+usr/lib/gnome-settings-daemon-3.0/libdatetime.so 29394
+usr/lib/libgeocode-glib.so.0.0.0 29393
+usr/lib/libgweather-3.so.6.3.2 29392
+usr/lib/gnome-settings-daemon-3.0/libcursor.so 29391
+usr/lib/gnome-settings-daemon-3.0/libupdates.so 29390
+usr/lib/i386-linux-gnu/libpackagekit-glib2.so.18.0.1 29389
+usr/lib/i386-linux-gnu/gio/modules/libgioremote-volume-monitor.so 29388
+usr/share/gvfs/remote-volume-monitors/afc.monitor 29387
+usr/share/gvfs/remote-volume-monitors/goa.monitor 29386
+usr/share/gvfs/remote-volume-monitors/gphoto2.monitor 29385
+usr/share/gvfs/remote-volume-monitors/mtp.monitor 29384
+usr/share/gvfs/remote-volume-monitors/udisks2.monitor 29383
+usr/lib/gvfs/gvfs-udisks2-volume-monitor 29382
+usr/lib/i386-linux-gnu/libudisks2.so.0.0.0 29381
+usr/bin/pactl 29380
+lib/systemd/system/udisks2.service 29379
+usr/lib/udisks2/udisksd 29378
+lib/i386-linux-gnu/libatasmart.so.4.0.5 29377
+usr/lib/gvfs/gvfs-mtp-volume-monitor 29376
+usr/lib/gvfs/gvfs-gphoto2-volume-monitor 29375
+usr/lib/i386-linux-gnu/libgphoto2.so.6.0.0 29374
+usr/lib/i386-linux-gnu/libgphoto2_port.so.10.1.1 29373
+usr/lib/i386-linux-gnu/libexif.so.12.3.3 29372
+usr/lib/gvfs/gvfs-goa-volume-monitor 29371
+usr/lib/i386-linux-gnu/libgoa-1.0.so.0.0.0 29370
+usr/lib/gvfs/gvfs-afc-volume-monitor 29367
+lib/systemd/system/systemd-hostnamed.service 29366
+usr/bin/gnome-shell 29365
+usr/lib/gnome-shell/libgnome-shell.so 29364
+usr/share/libwacom/serial-wacf004.tablet 29363
+usr/share/libwacom/n-trig-pen.tablet 29362
+usr/share/libwacom/isdv4-ef.tablet 29361
+usr/share/libwacom/isdv4-ed.tablet 29360
+usr/share/libwacom/isdv4-ec.tablet 29359
+usr/share/libwacom/isdv4-e6.tablet 29358
+usr/share/libwacom/isdv4-e5.tablet 29357
+usr/share/libwacom/isdv4-e3.tablet 29356
+usr/share/libwacom/isdv4-93.tablet 29355
+usr/share/libwacom/isdv4-90.tablet 29354
+usr/share/libwacom/isdv4-10f.tablet 29353
+usr/share/libwacom/isdv4-10d.tablet 29352
+usr/share/libwacom/isdv4-101.tablet 29351
+usr/share/libwacom/isdv4-100.tablet 29350
+usr/share/libwacom/intuos-pro-s.tablet 29349
+usr/share/libwacom/intuos-pro-m.tablet 29348
+usr/share/libwacom/intuos-pro-l.tablet 29347
+usr/share/libwacom/intuos-9x12.tablet 29346
+usr/share/libwacom/intuos-6x8.tablet 29345
+usr/share/libwacom/intuos5-touch-s.tablet 29344
+usr/share/libwacom/intuos5-touch-m.tablet 29343
+usr/share/libwacom/intuos5-touch-l.tablet 29342
+usr/share/libwacom/intuos5-s.tablet 29341
+usr/share/libwacom/intuos5-m.tablet 29340
+usr/share/libwacom/intuos-4x5.tablet 29339
+usr/share/libwacom/intuos4-8x13.tablet 29338
+usr/share/libwacom/intuos4-6x9-wl.tablet 29337
+usr/share/libwacom/intuos4-6x9.tablet 29336
+usr/share/libwacom/intuos4-4x6.tablet 29335
+usr/share/libwacom/intuos4-12x19.tablet 29334
+usr/share/libwacom/intuos3-9x12.tablet 29333
+usr/share/libwacom/intuos3-6x8.tablet 29332
+usr/share/libwacom/intuos3-6x11.tablet 29331
+usr/share/libwacom/intuos3-4x6.tablet 29330
+usr/share/libwacom/intuos3-4x5.tablet 29329
+usr/share/libwacom/intuos3-12x19.tablet 29328
+usr/share/libwacom/intuos3-12x12.tablet 29327
+usr/share/libwacom/intuos2-9x12.tablet 29326
+usr/share/libwacom/intuos2-6x8.tablet 29325
+usr/share/libwacom/intuos2-4x5.tablet 29324
+usr/share/libwacom/intuos2-12x18.tablet 29323
+usr/share/libwacom/intuos2-12x12.tablet 29322
+usr/share/libwacom/intuos-12x18.tablet 29321
+usr/share/libwacom/intuos-12x12.tablet 29320
+usr/share/libwacom/graphire-wireless-8x6.tablet 29319
+usr/share/libwacom/graphire4-4x5.tablet 29318
+usr/share/libwacom/graphire3-6x8.tablet 29317
+usr/share/libwacom/graphire3-4x5.tablet 29316
+usr/share/libwacom/generic.tablet 29315
+usr/share/libwacom/dtu-2231.tablet 29314
+usr/share/libwacom/dtu-1931.tablet 29313
+usr/share/libwacom/dtu-1631.tablet 29312
+usr/share/libwacom/dtk-2241.tablet 29311
+usr/share/libwacom/dti-520.tablet 29310
+usr/share/libwacom/dth-2242.tablet 29309
+usr/share/libwacom/dtf-720.tablet 29308
+usr/share/libwacom/cintiq-24hd-touch.tablet 29307
+usr/share/libwacom/cintiq-24hd.tablet 29306
+usr/share/libwacom/cintiq-22hdt.tablet 29305
+usr/share/libwacom/cintiq-22hd.tablet 29304
+usr/share/libwacom/cintiq-21ux.tablet 29303
+usr/share/libwacom/cintiq-21ux2.tablet 29302
+usr/share/libwacom/cintiq-20wsx.tablet 29301
+usr/share/libwacom/cintiq-13hd.tablet 29300
+usr/share/libwacom/cintiq-12wx.tablet 29299
+usr/share/libwacom/bamboo-pen.tablet 29298
+usr/share/libwacom/bamboo-one.tablet 29297
+usr/share/libwacom/bamboo-craft.tablet 29296
+usr/share/libwacom/bamboo-2fg.tablet 29295
+usr/share/libwacom/bamboo-2fg-6x8.tablet 29294
+usr/share/libwacom/bamboo-2fg-4x5.tablet 29293
+usr/share/libwacom/libwacom.stylus 29292
+usr/sbin/cupsd 29291
+lib/systemd/systemd-hostnamed 29290
+usr/lib/gnome-shell/libgnome-shell-js.so 29289
+usr/lib/libgjs.so.0.0.0 29288
+usr/lib/i386-linux-gnu/libcupsmime.so.1 29287
+usr/lib/i386-linux-gnu/libpaper.so.1.1.2 29286
+usr/lib/i386-linux-gnu/libtelepathy-glib.so.0.84.1 29285
+usr/lib/libmutter.so.0.0.0 29284
+usr/lib/i386-linux-gnu/libclutter-1.0.so.0.2000.0 29283
+etc/os-release 29282
+etc/NetworkManager/dispatcher.d/00-firewall.sh 29281
+usr/lib/i386-linux-gnu/libcogl-pango.so.20.2.0 29280
+lib/xtables/libxt_conntrack.so 29279
+etc/NetworkManager/dispatcher.d/00-save-env 29278
+usr/lib/gnome-shell/libgnome-shell-menu.so 29277
+usr/lib/i386-linux-gnu/libgstbase-1.0.so.0.404.0 29276
+etc/cups/cups-files.conf 29275
+etc/cups/cupsd.conf 29274
+etc/papersize 29273
+usr/share/cups/mime/command.types 29272
+usr/share/cups/mime/cupsfilters.types 29271
+usr/share/cups/mime/mime.types 29270
+usr/share/cups/mime/pstotiff.types 29269
+etc/cups/raw.types 29268
+usr/share/cups/mime/cupsfilters.convs 29267
+usr/share/cups/mime/mime.convs 29266
+usr/share/cups/mime/pstotiff.convs 29265
+etc/cups/raw.convs 29264
+usr/share/cups/banners/classified 29263
+usr/share/cups/banners/confidential 29262
+usr/share/cups/banners/form 29261
+usr/share/cups/banners/secret 29260
+usr/share/cups/banners/standard 29259
+usr/share/cups/banners/topsecret 29258
+usr/share/cups/banners/unclassified 29257
+etc/NetworkManager/dispatcher.d/01-wait-for-notification-recipient.sh 29256
+usr/lib/gnome-settings-daemon/gsd-printer 29255
+usr/lib/i386-linux-gnu/libgstreamer-1.0.so.0.404.0 29254
+usr/lib/i386-linux-gnu/libpolkit-agent-1.so.0.0.0 29253
+usr/lib/i386-linux-gnu/libcogl.so.20.2.0 29252
+usr/lib/i386-linux-gnu/libmozjs-24.so.0.0.0 29251
+usr/lib/i386-linux-gnu/libxkbcommon-x11.so.0.0.0 29250
+usr/lib/i386-linux-gnu/libxcb-randr.so.0.1.0 29249
+usr/lib/i386-linux-gnu/libwayland-server.so.0.1.0 29248
+usr/lib/i386-linux-gnu/libinput.so.5.0.0 29247
+usr/lib/i386-linux-gnu/libgbm.so.1.0.0 29246
+usr/lib/i386-linux-gnu/libcogl-path.so.20.2.0 29245
+usr/lib/i386-linux-gnu/libwayland-egl.so.1.0.0 29244
+usr/lib/i386-linux-gnu/libEGL.so.1.0.0 29243
+usr/lib/i386-linux-gnu/libxcb-xkb.so.1.0.0 29242
+usr/lib/i386-linux-gnu/libxcb-xfixes.so.0.0.0 29241
+usr/lib/i386-linux-gnu/libxcb-shape.so.0.0.0 29240
+usr/lib/i386-linux-gnu/libcanberra-0.30/libcanberra-alsa.so 29237
+usr/lib/girepository-1.0/Clutter-1.0.typelib 29236
+usr/lib/girepository-1.0/Json-1.0.typelib 29235
+usr/lib/i386-linux-gnu/girepository-1.0/GL-1.0.typelib 29234
+usr/lib/girepository-1.0/CoglPango-1.0.typelib 29233
+usr/lib/i386-linux-gnu/girepository-1.0/PangoCairo-1.0.typelib 29232
+usr/lib/i386-linux-gnu/girepository-1.0/PangoFT2-1.0.typelib 29231
+usr/lib/i386-linux-gnu/girepository-1.0/freetype2-2.0.typelib 29230
+usr/lib/i386-linux-gnu/girepository-1.0/fontconfig-2.0.typelib 29229
+usr/lib/girepository-1.0/Cogl-1.0.typelib 29228
+usr/lib/gjs/girepository-1.0/GjsPrivate-1.0.typelib 29227
+usr/lib/gnome-shell/Shell-0.1.typelib 29226
+usr/lib/girepository-1.0/TelepathyGLib-0.12.typelib 29225
+usr/lib/gnome-shell/St-1.0.typelib 29224
+usr/lib/gnome-shell/ShellMenu-0.1.typelib 29223
+usr/lib/i386-linux-gnu/girepository-1.0/NetworkManager-1.0.typelib 29222
+usr/lib/i386-linux-gnu/girepository-1.0/DBusGLib-1.0.typelib 29221
+usr/lib/i386-linux-gnu/girepository-1.0/NMClient-1.0.typelib 29220
+usr/lib/mutter/Meta-3.0.typelib 29219
+usr/lib/i386-linux-gnu/girepository-1.0/xfixes-4.0.typelib 29218
+usr/lib/girepository-1.0/GDesktopEnums-3.0.typelib 29217
+usr/lib/girepository-1.0/ClutterX11-1.0.typelib 29216
+usr/lib/i386-linux-gnu/girepository-1.0/Polkit-1.0.typelib 29215
+usr/lib/girepository-1.0/GnomeDesktop-3.0.typelib 29214
+usr/lib/gnome-shell/ShellJS-0.1.typelib 29213
+usr/lib/girepository-1.0/Caribou-1.0.typelib 29212
+usr/lib/i386-linux-gnu/girepository-1.0/IBus-1.0.typelib 29211
+usr/lib/girepository-1.0/Atspi-2.0.typelib 29208
+usr/share/gnome-shell/modes/classic.json 29207
+etc/gnome/defaults.list 29206
+usr/share/applications/mimeinfo.cache 29205
+usr/share/gnome/applications/vim.desktop 29204
+usr/share/gnome/applications/nm-connection-editor.desktop 29203
+usr/share/gnome/applications/gnome-power-statistics.desktop 29202
+usr/share/gnome/applications/openjdk-7-policytool.desktop 29201
+usr/share/gnome/applications/orca.desktop 29200
+usr/share/applications/gnome-bluetooth-panel.desktop 29199
+usr/lib/libreoffice/share/xdg/xsltfilter.desktop 29198
+usr/share/applications/traverso.desktop 29197
+usr/share/applications/liferea.desktop 29196
+usr/lib/libreoffice/share/xdg/math.desktop 29195
+usr/share/applications/sound-juicer.desktop 29194
+usr/share/applications/python3.4.desktop 29193
+usr/share/applications/pidgin.desktop 29192
+usr/share/applications/gnome-system-log.desktop 29191
+usr/share/applications/synaptic-kde.desktop 29190
+usr/share/applications/evince-previewer.desktop 29189
+usr/share/applications/ibus-setup-pinyin.desktop 29188
+usr/share/applications/tails-installer-launcher.desktop 29187
+usr/share/applications/gnome-sound-panel.desktop 29186
+usr/share/applications/poedit.desktop 29185
+usr/share/applications/org.gnome.Nautilus.desktop 29184
+usr/share/applications/simple-scan.desktop 29183
+usr/share/applications/gnome-disk-image-mounter.desktop 29182
+usr/share/applications/gnome-shell-wayland.desktop 29181
+usr/share/applications/seahorse.desktop 29180
+usr/share/applications/ibus-setup-anthy.desktop 29179
+usr/share/applications/gcr-prompter.desktop 29178
+usr/share/applications/gnome-search-tool.desktop 29177
+usr/share/applications/gcr-viewer.desktop 29176
+usr/share/applications/gnome-wacom-panel.desktop 29175
+usr/share/applications/gnome-terminal.desktop 29174
+usr/share/applications/yelp.desktop 29173
+usr/share/applications/pitivi.desktop 29172
+usr/share/applications/python2.7.desktop 29171
+usr/share/applications/gobby-0.5.desktop 29170
+usr/lib/libreoffice/share/xdg/startcenter.desktop 29169
+usr/share/applications/tails-documentation.desktop 29168
+usr/share/applications/gnome-control-center.desktop 29167
+usr/share/applications/unsafe-browser.desktop 29166
+usr/share/applications/gnome-search-panel.desktop 29165
+usr/share/applications/org.gnome.FileRoller.desktop 29164
+usr/share/applications/tails-about.desktop 29163
+usr/share/applications/tails-persistence-delete.desktop 29162
+usr/share/applications/tor-browser.desktop 29161
+usr/share/applications/brasero.desktop 29160
+usr/share/applications/gnome-panel.desktop 29159
+usr/share/applications/gstreamer-properties.desktop 29158
+usr/share/applications/org.gnome.Shell.PortalHelper.desktop 29157
+usr/share/applications/gnome-power-panel.desktop 29156
+usr/share/applications/audacity.desktop 29155
+usr/share/applications/org.gnome.gedit.desktop 29154
+usr/share/applications/tails-persistence-setup.desktop 29153
+usr/share/applications/gnome-info-panel.desktop 29152
+usr/share/applications/gnome-wm.desktop 29151
+usr/share/applications/nm-applet.desktop 29150
+usr/share/applications/gnome-shell.desktop 29149
+usr/share/applications/ibus-setup-bopomofo.desktop 29148
+usr/share/applications/gnome-region-panel.desktop 29147
+usr/share/applications/gnome-calculator.desktop 29146
+usr/share/applications/evince.desktop 29145
+usr/share/applications/gnome-keyboard-panel.desktop 29144
+usr/share/applications/gnome-notifications-panel.desktop 29143
+usr/share/applications/gkbd-keyboard-display.desktop 29142
+usr/share/applications/gnome-disks.desktop 29141
+usr/lib/libreoffice/share/xdg/calc.desktop 29140
+usr/share/applications/brasero-nautilus.desktop 29139
+usr/share/applications/gnome-shell-extension-prefs.desktop 29138
+usr/share/applications/bookletimposer.desktop 29137
+usr/share/applications/eog.desktop 29136
+usr/share/applications/ibus-setup-hangul.desktop 29135
+usr/share/applications/gnome-datetime-panel.desktop 29134
+usr/share/applications/ibus-setup.desktop 29133
+usr/share/applications/gnome-universal-access-panel.desktop 29132
+usr/share/applications/electrum.desktop 29131
+usr/share/applications/nautilus-classic.desktop 29130
+usr/share/applications/gnome-color-panel.desktop 29129
+usr/share/applications/dasher.desktop 29128
+usr/share/applications/gnome-mouse-panel.desktop 29127
+usr/share/applications/gnome-system-monitor.desktop 29126
+usr/share/applications/gtkhash.desktop 29125
+usr/lib/libreoffice/share/xdg/writer.desktop 29124
+usr/share/applications/gnome-disk-image-writer.desktop 29123
+usr/share/applications/gnome-printers-panel.desktop 29122
+usr/share/applications/org.gnome.Totem.desktop 29121
+usr/share/applications/keepassx.desktop 29120
+usr/share/applications/icedove.desktop 29119
+usr/share/applications/mutter-wayland.desktop 29118
+usr/lib/libreoffice/share/xdg/impress.desktop 29117
+usr/share/applications/gimp.desktop 29116
+usr/share/applications/seahorse-pgp-encrypted.desktop 29115
+usr/share/applications/notification-daemon.desktop 29114
+usr/share/applications/gnome-display-panel.desktop 29113
+usr/share/applications/org.gnome.Screenshot.desktop 29112
+usr/share/applications/onioncircuits.desktop 29111
+usr/share/applications/gnome-sharing-panel.desktop 29110
+usr/share/applications/gnome-screensaver.desktop 29109
+usr/share/applications/evolution-calendar.desktop 29108
+usr/lib/libreoffice/share/xdg/draw.desktop 29107
+usr/share/applications/gnome-network-panel.desktop 29106
+usr/share/applications/nautilus-connect-server.desktop 29105
+usr/share/applications/gnome-privacy-panel.desktop 29104
+usr/share/applications/gnome-background-panel.desktop 29103
+usr/share/applications/seahorse-pgp-keys.desktop 29102
+usr/share/applications/inkscape.desktop 29101
+usr/share/applications/mat.desktop 29100
+usr/share/applications/gnome-user-accounts-panel.desktop 29099
+usr/share/applications/gnome-system-monitor-kde.desktop 29098
+usr/share/applications/nautilus-autorun-software.desktop 29097
+usr/share/applications/scribus.desktop 29096
+usr/share/applications/seahorse-pgp-signature.desktop 29095
+usr/share/applications/mutter.desktop 29094
+usr/share/applications/whisperback.desktop 29093
+usr/share/applications/onionshare.desktop 29092
+usr/share/gnome-shell/theme/gnome-classic.css 29091
+usr/share/gnome-shell/theme/gnome-shell.css 29090
+usr/share/tails/screensaver_background.png 29089
+usr/share/xml/iso-codes/iso_639_3.xml 29088
+usr/bin/ibus-daemon 29087
+usr/share/ibus/keymaps/us 29086
+usr/share/ibus/keymaps/common 29085
+usr/share/ibus/keymaps/modifiers 29084
+usr/share/ibus/component/anthy.xml 29083
+usr/lib/ibus/ibus-engine-anthy 29082
+usr/share/locale/en/LC_MESSAGES/gnome-desktop-3.0.mo 29081
+bin/false 29080
+usr/share/ibus-anthy/engine/main.py 29079
+usr/lib/girepository-1.0/NMGtk-1.0.typelib 29078
+usr/lib/girepository-1.0/GnomeBluetooth-1.0.typelib 29077
+usr/lib/libgnome-bluetooth.so.13.0.0 29076
+usr/lib/python3.4/getopt.py 29075
+usr/lib/girepository-1.0/UPowerGlib-1.0.typelib 29074
+usr/lib/gnome-shell/Gvc-1.0.typelib 29073
+usr/lib/python3.4/xml/__init__.py 29072
+usr/lib/python3.4/xml/dom/__init__.py 29071
+usr/lib/python3.4/xml/dom/domreg.py 29070
+usr/lib/python3.4/xml/dom/minidom.py 29069
+usr/share/xsessions/gnome-classic.desktop 29068
+usr/share/xsessions/gnome-fallback.desktop 29067
+usr/share/xsessions/gnome.desktop 29066
+usr/share/wayland-sessions/gnome-wayland.desktop 29065
+usr/lib/python3.4/xml/dom/minicompat.py 29064
+usr/lib/python3.4/xml/dom/xmlbuilder.py 29063
+usr/lib/python3.4/xml/dom/NodeFilter.py 29062
+usr/lib/python3/dist-packages/gi/__init__.py 29061
+usr/lib/python3.4/pkgutil.py 29060
+usr/lib/python3.4/importlib/util.py 29059
+usr/lib/python3/dist-packages/gi/_gi.cpython-34m-i386-linux-gnu.so 29058
+usr/lib/i386-linux-gnu/girepository-1.0/PolkitAgent-1.0.typelib 29057
+usr/lib/girepository-1.0/TelepathyLogger-0.2.typelib 29056
+usr/lib/girepository-1.0/Gcr-3.typelib 29055
+usr/lib/girepository-1.0/Gck-1.typelib 29054
+usr/lib/python3/dist-packages/gi/_error.py 29053
+usr/lib/python3/dist-packages/gi/repository/__init__.py 29052
+usr/lib/python3/dist-packages/gi/importer.py 29051
+usr/lib/python3/dist-packages/gi/module.py 29050
+usr/lib/python3/dist-packages/gi/overrides/__init__.py 29049
+usr/lib/python3/dist-packages/gi/_constants.py 29048
+usr/lib/python3/dist-packages/gi/types.py 29047
+usr/lib/python3/dist-packages/gi/docstring.py 29046
+usr/lib/python3/dist-packages/gi/_propertyhelper.py 29045
+usr/share/gnome-shell/theme/noise-texture.png 29044
+usr/lib/python3/dist-packages/gi/_signalhelper.py 29043
+usr/share/gnome-shell/search-providers/gnome-calculator-search-provider.ini 29042
+usr/share/gnome-shell/search-providers/gnome-control-center-search-provider.ini 29041
+usr/share/gnome-shell/search-providers/gnome-terminal-search-provider.ini 29040
+etc/NetworkManager/dispatcher.d/01ifupdown 29039
+usr/lib/python3/dist-packages/gi/overrides/GLib.py 29038
+usr/share/gnome-shell/search-providers/nautilus-search-provider.ini 29037
+usr/share/gnome-shell/search-providers/seahorse-search-provider.ini 29036
+usr/lib/python3/dist-packages/gi/_option.py 29035
+usr/lib/python3.4/optparse.py 29034
+usr/lib/python3/dist-packages/gi/overrides/IBus.py 29033
+usr/lib/python3/dist-packages/gi/overrides/GObject.py 29032
+usr/lib/python3/dist-packages/gi/overrides/Gio.py 29031
+usr/lib/i386-linux-gnu/gio/modules/libgiognutls.so 29030
+usr/local/lib/start-systemd-desktop-target 29029
+usr/share/ibus-anthy/engine/_config.py 29028
+usr/bin/xargs 29026
+usr/lib/systemd/user/desktop.target 29025
+usr/lib/systemd/user/tails-wait-until-tor-has-bootstrapped.service 29024
+usr/lib/systemd/user/tails-virt-notify-user.service 29023
+usr/lib/systemd/user/tails-upgrade-frontend.service 29022
+usr/lib/systemd/user/tails-security-check.service 29021
+usr/lib/systemd/user/tails-configure-keyboard.service 29020
+usr/bin/nautilus 29019
+lib/init/vars.sh 29018
+usr/local/lib/tails-configure-keyboard 29017
+usr/local/lib/tails-virt-notify-user 29016
+etc/ssl/certs/ca-certificates.crt 29015
+usr/share/ibus-anthy/engine/factory.py 29014
+usr/share/ibus-anthy/engine/engine.py 29013
+etc/default/rcS 29012
+usr/share/perl5/Desktop/Notify.pm 29011
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus.pm 29010
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Net/DBus/DBus.so 29009
+lib/init/mount-functions.sh 29008
+usr/lib/girepository-1.0/Anthy-9000.typelib 29007
+usr/share/ibus-anthy/engine/tables.py 29006
+usr/share/ibus-anthy/engine/jastring.py 29005
+usr/lib/i386-linux-gnu/libtracker-sparql-1.0.so.0.202.2 29004
+usr/bin/florence 29003
+usr/share/ibus-anthy/engine/romaji.py 29002
+usr/share/ibus-anthy/engine/segment.py 29001
+usr/share/ibus-anthy/engine/kana.py 29000
+etc/NetworkManager/dispatcher.d/10-tor.sh 28999
+usr/share/ibus-anthy/engine/thumb.py 28998
+usr/share/ibus-anthy/setup/anthyprefs.py 28997
+usr/share/ibus-anthy/setup/prefs.py 28996
+usr/share/ibus-anthy/engine/default.xml 28995
+usr/share/ibus/component/dconf.xml 28994
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Bus.pm 28993
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Connection.pm 28992
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/MethodCall.pm 28991
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message.pm 28990
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Iterator.pm 28989
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/Signal.pm 28988
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/MethodReturn.pm 28987
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Message/Error.pm 28986
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/PendingCall.pm 28985
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Service.pm 28984
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/RemoteService.pm 28983
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/RemoteObject.pm 28982
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Introspector.pm 28981
+usr/share/perl5/XML/Twig.pm 28980
+etc/tor/torrc 28979
+usr/share/ibus/component/gtkpanel.xml 28978
+usr/share/ibus/component/hangul.xml 28977
+usr/share/ibus/component/pinyin.xml 28976
+usr/share/ibus/component/simple.xml 28975
+usr/share/ibus/component/unikey.xml 28974
+usr/lib/ibus-unikey/ibus-engine-unikey 28973
+usr/local/sbin/restart-tor 28972
+etc/NetworkManager/dispatcher.d/20-time.sh 28971
+usr/local/lib/tails-shell-library/gnome.sh 28970
+bin/tempfile 28969
+bin/su 28968
+usr/bin/tail 28967
+usr/lib/ibus/ibus-dconf 28966
+usr/bin/tor 28965
+etc/pam.d/su 28964
+usr/lib/libnautilus-extension.so.1.4.0 28963
+lib/i386-linux-gnu/security/pam_mail.so 28962
+usr/share/perl/5.20.2/UNIVERSAL.pm 28961
+usr/lib/i386-linux-gnu/libgailutil-3.so.0.0.0 28960
+usr/lib/i386-linux-gnu/libexempi.so.3.2.3 28959
+usr/lib/ibus/ibus-x11 28958
+usr/lib/i386-linux-gnu/perl5/5.20/XML/Parser.pm 28957
+usr/lib/i386-linux-gnu/perl5/5.20/XML/Parser/Expat.pm 28956
+usr/lib/i386-linux-gnu/perl5/5.20/auto/XML/Parser/Expat/Expat.so 28955
+usr/lib/i386-linux-gnu/libgtk-x11-2.0.so.0.2400.25 28954
+etc/dconf/profile/ibus 28953
+etc/dconf/db/ibus 28952
+usr/bin/nm-applet 28950
+usr/lib/i386-linux-gnu/libflorence-1.0.so.1.0.0 28949
+usr/lib/i386-linux-gnu/libnm-gtk.so.0.0.0 28948
+usr/lib/notification-daemon/notification-daemon 28947
+usr/local/lib/tails-htp-notify-user 28946
+usr/lib/i386-linux-gnu/perl/5.20.2/Data/Dumper.pm 28945
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Data/Dumper/Dumper.so 28944
+usr/lib/i386-linux-gnu/gio/modules/libgiolibproxy.so 28943
+usr/lib/i386-linux-gnu/libproxy.so.1.0.0 28942
+usr/bin/torsocks 28941
+usr/lib/policykit-1-gnome/polkit-gnome-authentication-agent-1 28940
+sbin/getcap 28939
+usr/lib/i386-linux-gnu/libevent-2.0.so.5.1.9 28938
+usr/bin/openpgp-applet 28937
+usr/lib/i386-linux-gnu/libnm-glib-vpn.so.1.2.0 28936
+usr/lib/i386-linux-gnu/torsocks/libtorsocks.so.0.0.0 28935
+etc/tor/torsocks.conf 28934
+usr/lib/i386-linux-gnu/gio/modules/libgiognomeproxy.so 28933
+usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/metadata.json 28932
+usr/lib/i386-linux-gnu/perl5/5.20/Glib.pm 28931
+usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/extension.js 28930
+usr/share/gnome-shell/extensions/alternate-tab@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28929
+usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 28928
+usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/extension.js 28927
+usr/lib/i386-linux-gnu/girepository-1.0/GMenu-3.0.typelib 28926
+usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/convenience.js 28925
+usr/share/gnome-shell/extensions/apps-menu@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28924
+usr/lib/libgnome-menu-3.so.0.0.1 28923
+etc/xdg/menus/gnome-applications.menu 28922
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Glib/Glib.so 28921
+etc/xdg/menus/applications-merged/Tails.menu 28920
+usr/share/applications/gnome-power-statistics.desktop 28919
+usr/share/applications/nm-connection-editor.desktop 28918
+usr/lib/i386-linux-gnu/tracker-1.0/libtracker-data.so.0.0.0 28917
+usr/share/applications/openjdk-7-policytool.desktop 28916
+usr/share/applications/orca.desktop 28915
+usr/share/applications/vim.desktop 28914
+usr/share/desktop-directories/ActionGames.directory 28913
+usr/share/desktop-directories/AdventureGames.directory 28912
+usr/share/desktop-directories/ArcadeGames.directory 28911
+usr/share/desktop-directories/AudioVideo.directory 28910
+usr/share/desktop-directories/BlocksGames.directory 28909
+usr/share/desktop-directories/BoardGames.directory 28908
+usr/share/desktop-directories/CardGames.directory 28907
+usr/share/desktop-directories/Debian.directory 28906
+usr/share/desktop-directories/Development.directory 28905
+usr/share/desktop-directories/Education.directory 28904
+usr/share/desktop-directories/Game.directory 28903
+usr/share/desktop-directories/GnomeScience.directory 28902
+usr/share/desktop-directories/Graphics.directory 28901
+usr/lib/i386-linux-gnu/tracker-1.0/libtracker-common.so.0.0.0 28900
+usr/share/desktop-directories/KidsGames.directory 28899
+usr/share/desktop-directories/LogicGames.directory 28898
+usr/share/desktop-directories/Network.directory 28897
+usr/share/desktop-directories/Office.directory 28896
+usr/share/desktop-directories/RolePlayingGames.directory 28895
+usr/share/desktop-directories/Settings-System.directory 28894
+usr/share/desktop-directories/Settings.directory 28893
+usr/share/desktop-directories/SimulationGames.directory 28892
+usr/share/desktop-directories/SportsGames.directory 28891
+usr/share/desktop-directories/StrategyGames.directory 28890
+usr/share/desktop-directories/System-Tools.directory 28889
+usr/share/desktop-directories/Tails.directory 28888
+usr/share/desktop-directories/Utility-Accessibility.directory 28887
+usr/share/desktop-directories/Utility.directory 28886
+usr/share/desktop-directories/X-GNOME-Menu-Applications.directory 28885
+usr/share/desktop-directories/X-GNOME-Other.directory 28884
+usr/share/desktop-directories/X-GNOME-Sundry.directory 28883
+usr/share/desktop-directories/X-GNOME-SystemSettings.directory 28882
+usr/share/desktop-directories/X-GNOME-Utilities.directory 28881
+usr/share/desktop-directories/X-GNOME-WebApplications.directory 28880
+usr/local/lib/tor-browser/browser/icons/mozicon128.png 28879
+usr/share/icons/hicolor/32x32/apps/icedove.png 28878
+usr/share/icons/hicolor/32x32/apps/pidgin.png 28877
+usr/share/icons/hicolor/32x32/apps/keepassx.png 28876
+usr/share/icons/Adwaita/32x32/apps/utilities-terminal.png 28875
+usr/lib/i386-linux-gnu/libgdk-x11-2.0.so.0.2400.25 28874
+usr/lib/i386-linux-gnu/libunistring.so.0.1.2 28873
+usr/share/gnome-shell/extensions/auto-move-windows@gnome-shell-extensions.gcampax.github.com/metadata.json 28872
+usr/share/gnome-shell/extensions/drive-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 28871
+usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/metadata.json 28870
+usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/extension.js 28869
+usr/share/gnome-shell/extensions/launch-new-instance@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28868
+usr/share/gnome-shell/extensions/native-window-placement@gnome-shell-extensions.gcampax.github.com/metadata.json 28867
+usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/metadata.json 28866
+usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/extension.js 28865
+usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/convenience.js 28864
+usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/placeDisplay.js 28863
+usr/share/gnome-shell/extensions/places-menu@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28862
+usr/share/gnome-shell/extensions/screenshot-window-sizer@gnome-shell-extensions.gcampax.github.com/metadata.json 28861
+usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/metadata.json 28860
+usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/extension.js 28859
+usr/share/gnome-shell/extensions/shutdown-helper@tails.boum.org/lib.js 28858
+usr/share/gnome-shell/extensions/systemMonitor@gnome-shell-extensions.gcampax.github.com/metadata.json 28857
+usr/share/gnome-shell/extensions/topIcons@adel.gadllah@gmail.com/metadata.json 28856
+usr/share/gnome-shell/extensions/topIcons@adel.gadllah@gmail.com/extension.js 28855
+usr/share/nm-applet/info.ui 28854
+usr/lib/NetworkManager/nm-applet-migration-tool 28853
+usr/lib/i386-linux-gnu/libgnome-keyring.so.0.2.0 28852
+usr/share/gnome-shell/extensions/torstatus@tails.boum.org/metadata.json 28851
+usr/share/gnome-shell/extensions/torstatus@tails.boum.org/extension.js 28850
+usr/share/gnome-shell/extensions/user-theme@gnome-shell-extensions.gcampax.github.com/metadata.json 28849
+usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/metadata.json 28848
+usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/extension.js 28847
+usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/convenience.js 28846
+usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/classic.css 28845
+usr/share/gnome-shell/extensions/window-list@gnome-shell-extensions.gcampax.github.com/stylesheet.css 28844
+usr/share/gnome-shell/extensions/windowsNavigator@gnome-shell-extensions.gcampax.github.com/metadata.json 28843
+usr/share/gnome-shell/extensions/workspace-indicator@gnome-shell-extensions.gcampax.github.com/metadata.json 28842
+usr/share/fonts/truetype/dejavu/DejaVuSansMono.ttf 28841
+usr/lib/i386-linux-gnu/gconf/gconfd-2 28840
+etc/gconf/gconf.xml.defaults/%gconf-tree.xml 28839
+var/lib/gconf/debian.defaults/%gconf-tree.xml 28838
+var/lib/gconf/defaults/%gconf-tree.xml 28837
+usr/share/perl5/Gtk3.pm 28836
+usr/lib/i386-linux-gnu/perl5/5.20/Cairo/GObject.pm 28835
+usr/share/icons/gnome/16x16/devices/network-wired.png 28834
+usr/lib/i386-linux-gnu/perl5/5.20/Cairo.pm 28833
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Cairo/Cairo.so 28832
+usr/share/gnome-shell/theme/classic-process-working.svg 28831
+usr/share/icons/Adwaita/scalable/apps/preferences-desktop-accessibility-symbolic.svg 28830
+usr/share/icons/hicolor/scalable/status/tor-disconnected-symbolic.svg 28829
+usr/share/icons/Adwaita/scalable/actions/find-location-symbolic.svg 28828
+usr/share/X11/xkb/symbols/kr 28827
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Cairo/GObject/GObject.so 28826
+usr/lib/ibus/ibus-engine-simple 28825
+usr/share/icons/Adwaita/scalable/actions/system-shutdown-symbolic.svg 28824
+usr/share/icons/Adwaita/scalable/status/user-available-symbolic.svg 28823
+usr/share/icons/Adwaita/scalable/devices/audio-speakers-symbolic.svg 28822
+usr/share/icons/Adwaita/scalable/status/audio-volume-medium-symbolic.svg 28821
+usr/lib/i386-linux-gnu/perl5/5.20/Glib/Object/Introspection.pm 28820
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/ASyncReply.pm 28819
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Annotation.pm 28818
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockConnection.pm 28817
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Error.pm 28816
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockMessage.pm 28815
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Test/MockIterator.pm 28814
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Value.pm 28813
+usr/share/perl5/Desktop/Notify/Notification.pm 28812
+usr/share/perl5/Class/Accessor.pm 28811
+usr/share/perl5/IPC/System/Simple.pm 28810
+usr/share/perl5/URI.pm 28809
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Glib/Object/Introspection/Introspection.so 28808
+usr/share/perl5/URI/Escape.pm 28807
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Reactor.pm 28806
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Binding/Watch.pm 28805
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/Callback.pm 28804
+usr/lib/i386-linux-gnu/perl/5.20.2/Time/HiRes.pm 28803
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Time/HiRes/HiRes.so 28802
+usr/share/perl5/Gtk3/SimpleList.pm 28801
+usr/bin/systemd-detect-virt 28800
+usr/lib/i386-linux-gnu/libseccomp.so.2.1.1 28799
+usr/lib/nautilus/extensions-3.0/libevince-properties-page.so 28798
+usr/lib/libevdocument3.so.4.0.0 28797
+usr/share/perl5/Crypt/OpenPGP_Applet/GnuPG/Interface.pm 28796
+usr/share/perl5/namespace/autoclean.pm 28795
+usr/share/perl5/B/Hooks/EndOfScope.pm 28794
+usr/share/perl5/Module/Implementation.pm 28793
+usr/share/perl5/Try/Tiny.pm 28792
+usr/share/perl5/B/Hooks/EndOfScope/XS.pm 28791
+usr/lib/i386-linux-gnu/perl5/5.20/Variable/Magic.pm 28790
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Variable/Magic/Magic.so 28789
+usr/share/perl5/namespace/clean.pm 28788
+usr/share/perl5/Package/Stash.pm 28787
+usr/lib/i386-linux-gnu/perl5/5.20/Package/Stash/XS.pm 28786
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Package/Stash/XS/XS.so 28785
+usr/lib/i386-linux-gnu/perl5/5.20/Sub/Identify.pm 28784
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Sub/Identify/Identify.so 28783
+usr/lib/i386-linux-gnu/gstreamer1.0/gstreamer-1.0/gst-plugin-scanner 28782
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgnl.so 28781
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgst1394.so 28780
+usr/lib/i386-linux-gnu/libavc1394.so.0.3.0 28779
+usr/lib/i386-linux-gnu/librom1394.so.0.3.0 28778
+usr/lib/i386-linux-gnu/perl5/5.20/DateTime.pm 28777
+usr/lib/i386-linux-gnu/libiec61883.so.0.1.1 28776
+usr/lib/i386-linux-gnu/libraw1394.so.11.1.0 28775
+usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Duration.pm 28774
+usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Helpers.pm 28773
+usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate.pm 28772
+usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate/Constants.pm 28771
+usr/lib/i386-linux-gnu/perl5/5.20/Params/Validate/XS.pm 28770
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Params/Validate/XS/XS.so 28769
+usr/share/perl5/DateTime/Locale.pm 28768
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsta52dec.so 28767
+usr/lib/i386-linux-gnu/libgstaudio-1.0.so.0.404.0 28766
+usr/share/perl5/DateTime/Locale/Base.pm 28765
+usr/share/perl5/DateTime/Locale/Catalog.pm 28764
+usr/share/perl5/DateTime/TimeZone.pm 28763
+usr/lib/i386-linux-gnu/liba52-0.7.4.so 28762
+usr/lib/i386-linux-gnu/libgsttag-1.0.so.0.404.0 28761
+usr/share/perl5/DateTime/TimeZone/Catalog.pm 28760
+usr/share/perl5/DateTime/TimeZone/Floating.pm 28759
+usr/share/perl5/Class/Singleton.pm 28758
+usr/share/perl5/DateTime/TimeZone/OffsetOnly.pm 28757
+usr/share/perl5/DateTime/TimeZone/UTC.pm 28756
+usr/share/perl5/DateTime/TimeZone/Local.pm 28755
+usr/share/perl5/Class/Load.pm 28754
+usr/share/perl5/Data/OptList.pm 28753
+usr/lib/i386-linux-gnu/perl5/5.20/Params/Util.pm 28752
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Params/Util/Util.so 28751
+usr/share/perl5/Sub/Install.pm 28750
+usr/lib/i386-linux-gnu/perl5/5.20/Class/Load/XS.pm 28749
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Class/Load/XS/XS.so 28748
+usr/lib/i386-linux-gnu/perl5/5.20/auto/DateTime/DateTime.so 28747
+usr/lib/i386-linux-gnu/perl5/5.20/DateTime/Infinite.pm 28746
+usr/share/perl5/DateTime/Locale/en_US.pm 28745
+usr/share/perl5/DateTime/Locale/en.pm 28744
+usr/share/perl5/DateTime/Locale/root.pm 28743
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaasink.so 28742
+usr/lib/i386-linux-gnu/libgstvideo-1.0.so.0.404.0 28741
+usr/lib/evince/4/backends/comicsdocument.evince-backend 28740
+usr/lib/evince/4/backends/djvudocument.evince-backend 28739
+usr/lib/evince/4/backends/dvidocument.evince-backend 28738
+usr/share/perl5/File/ShareDir.pm 28737
+usr/share/perl5/Class/Inspector.pm 28736
+usr/lib/evince/4/backends/pdfdocument.evince-backend 28735
+usr/lib/evince/4/backends/psdocument.evince-backend 28734
+usr/lib/evince/4/backends/tiffdocument.evince-backend 28733
+usr/lib/evince/4/backends/xpsdocument.evince-backend 28732
+usr/lib/nautilus/extensions-3.0/libgtkhash-properties.so 28731
+usr/lib/i386-linux-gnu/libmhash.so.2.0.1 28730
+usr/share/perl5/Locale/TextDomain.pm 28729
+usr/share/perl5/Locale/Messages.pm 28728
+usr/lib/i386-linux-gnu/libaa.so.1.0.4 28727
+usr/lib/nautilus/extensions-3.0/libnautilus-brasero-extension.so 28726
+usr/lib/libbrasero-utils3.so.1.2.6 28725
+usr/share/perl5/Locale/gettext_pp.pm 28724
+lib/i386-linux-gnu/libslang.so.2.3.0 28723
+usr/share/perl5/Locale/Recode.pm 28722
+usr/share/perl5/Locale/Recode/_Conversions.pm 28721
+usr/lib/libbrasero-media3.so.1.2.6 28720
+usr/share/icons/hicolor/16x16/apps/seahorse.png 28719
+usr/lib/i386-linux-gnu/libgpm.so.2 28718
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaccurip.so 28717
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadder.so 28716
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadpcmdec.so 28715
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstadpcmenc.so 28714
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaiff.so 28713
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalaw.so 28712
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalpha.so 28711
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstalphacolor.so 28710
+usr/share/perl5/auto/share/dist/OpenPGP_Applet/pixmaps/22x22/OpenPGP_Applet-text.png 28709
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstamrnb.so 28708
+usr/lib/i386-linux-gnu/libopencore-amrnb.so.0.0.3 28707
+usr/lib/libbrasero-burn3.so.1.2.6 28706
+usr/lib/i386-linux-gnu/libgstpbutils-1.0.so.0.404.0 28705
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstamrwbdec.so 28704
+usr/lib/i386-linux-gnu/libopencore-amrwb.so.0.0.3 28703
+usr/share/themes/Adwaita/gtk-2.0/gtkrc 28702
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstapetag.so 28701
+usr/lib/libtotem-plparser.so.18.1.0 28700
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstapp.so 28699
+usr/lib/i386-linux-gnu/libgmime-2.6.so.0.620.0 28698
+usr/lib/i386-linux-gnu/libgstapp-1.0.so.0.404.0 28697
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstasf.so 28696
+usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/engines/libpixmap.so 28695
+usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/engines/libadwaita.so 28694
+usr/share/themes/Default/gtk-2.0-key/gtkrc 28693
+usr/lib/i386-linux-gnu/libquvi.so.7.0.1 28692
+usr/lib/i386-linux-gnu/libarchive.so.13.1.2 28691
+usr/lib/i386-linux-gnu/libgstriff-1.0.so.0.404.0 28690
+usr/lib/i386-linux-gnu/libgstrtsp-1.0.so.0.404.0 28689
+usr/share/tor/tor-service-defaults-torrc 28688
+usr/lib/i386-linux-gnu/libgstsdp-1.0.so.0.404.0 28687
+usr/lib/i386-linux-gnu/libgstrtp-1.0.so.0.404.0 28686
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstasfmux.so 28685
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstassrender.so 28684
+usr/lib/i386-linux-gnu/libass.so.5.0.0 28683
+usr/lib/i386-linux-gnu/libgpgme-pthread.so.11.13.0 28682
+usr/lib/i386-linux-gnu/libfribidi.so.0.3.5 28681
+usr/lib/i386-linux-gnu/libenca.so.0.5.1 28680
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioconvert.so 28679
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiofx.so 28678
+usr/share/tor/geoip 28677
+usr/lib/i386-linux-gnu/libgstfft-1.0.so.0.404.0 28676
+usr/lib/i386-linux-gnu/libcurl-gnutls.so.4.3.0 28675
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiofxbad.so 28674
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiomixer.so 28673
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioparsers.so 28672
+usr/lib/i386-linux-gnu/liblua5.2.so.0.0.0 28671
+lib/i386-linux-gnu/liblzo2.so.2.0.0 28670
+usr/lib/i386-linux-gnu/libidn.so.11.6.12 28669
+usr/lib/i386-linux-gnu/librtmp.so.1 28668
+usr/lib/i386-linux-gnu/libssh2.so.1.0.1 28667
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiorate.so 28666
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudioresample.so 28665
+usr/lib/i386-linux-gnu/liborc-test-0.4.so.0.22.0 28664
+usr/lib/i386-linux-gnu/liblber-2.4.so.2.10.3 28663
+usr/lib/i386-linux-gnu/libldap_r-2.4.so.2.10.3 28662
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiotestsrc.so 28661
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstaudiovisualizers.so 28660
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstauparse.so 28659
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstautoconvert.so 28658
+usr/lib/i386-linux-gnu/libsasl2.so.2.0.25 28657
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstautodetect.so 28656
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstavi.so 28655
+usr/lib/nautilus/extensions-3.0/libnautilus-fileroller.so 28654
+usr/lib/nautilus/extensions-3.0/libnautilus-python.so 28653
+usr/lib/i386-linux-gnu/libpython2.7.so.1.0 28652
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstbayer.so 28651
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstbz2.so 28650
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcacasink.so 28649
+usr/lib/i386-linux-gnu/libcaca.so.0.99.19 28648
+lib/i386-linux-gnu/libncursesw.so.5.9 28647
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcairo.so 28646
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcamerabin2.so 28645
+usr/lib/i386-linux-gnu/libgstphotography-1.0.so.0.404.0 28644
+usr/lib/i386-linux-gnu/libgstbasecamerabinsrc-1.0.so.0.404.0 28643
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcdio.so 28642
+usr/lib/libcdio.so.13.0.0 28641
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcdparanoia.so 28640
+usr/lib/i386-linux-gnu/libcdda_interface.so.0.10.2 28639
+usr/lib/i386-linux-gnu/libcdda_paranoia.so.0.10.2 28638
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstchromaprint.so 28637
+usr/lib/i386-linux-gnu/libchromaprint.so.0.2.3 28636
+usr/lib/i386-linux-gnu/i686/cmov/libavcodec.so.56.1.0 28635
+usr/lib/i386-linux-gnu/i686/cmov/libavutil.so.54.3.0 28634
+usr/lib/i386-linux-gnu/i686/cmov/libavresample.so.2.1.0 28633
+usr/lib/i386-linux-gnu/libxvidcore.so.4.3 28632
+usr/lib/python2.7/dist-packages/gi/_gobject/__init__.py 28631
+usr/lib/girepository-1.0/Nautilus-3.0.typelib 28630
+usr/share/nautilus-python/extensions/nautilus-mat.py 28629
+usr/lib/python2.7/dist-packages/MAT/__init__.py 28628
+usr/lib/python2.7/dist-packages/MAT/mat.py 28627
+usr/lib/python2.7/mimetypes.py 28626
+usr/lib/python2.7/xml/sax/__init__.py 28625
+usr/lib/python2.7/xml/sax/xmlreader.py 28624
+usr/lib/python2.7/xml/sax/handler.py 28623
+usr/lib/python2.7/xml/sax/_exceptions.py 28622
+usr/lib/python2.7/dist-packages/hachoir_core/__init__.py 28621
+usr/lib/python2.7/dist-packages/hachoir_core/version.py 28620
+usr/lib/python2.7/dist-packages/hachoir_core/cmd_line.py 28619
+usr/lib/python2.7/dist-packages/hachoir_core/log.py 28618
+usr/lib/python2.7/dist-packages/hachoir_core/config.py 28617
+usr/lib/python2.7/dist-packages/hachoir_core/i18n.py 28616
+usr/lib/python2.7/encodings/utf_32_be.py 28615
+usr/lib/python2.7/encodings/latin_1.py 28614
+usr/lib/python2.7/encodings/iso8859_15.py 28613
+usr/lib/python2.7/encodings/mac_roman.py 28612
+usr/lib/python2.7/encodings/iso8859_7.py 28611
+usr/lib/python2.7/dist-packages/hachoir_core/tools.py 28610
+usr/lib/python2.7/dist-packages/hachoir_parser/__init__.py 28609
+usr/lib/python2.7/dist-packages/hachoir_parser/version.py 28608
+usr/lib/python2.7/dist-packages/hachoir_parser/parser.py 28607
+usr/lib/python2.7/dist-packages/hachoir_core/field/__init__.py 28606
+usr/lib/python2.7/dist-packages/hachoir_core/field/field.py 28605
+usr/lib/python2.7/dist-packages/hachoir_core/compatibility.py 28604
+usr/lib/python2.7/dist-packages/hachoir_core/stream/__init__.py 28603
+usr/lib/python2.7/dist-packages/hachoir_core/endian.py 28602
+usr/lib/python2.7/dist-packages/hachoir_core/stream/stream.py 28601
+usr/lib/python2.7/dist-packages/hachoir_core/error.py 28600
+usr/lib/python2.7/dist-packages/hachoir_core/stream/input.py 28599
+usr/lib/python2.7/dist-packages/hachoir_core/bits.py 28598
+usr/lib/python2.7/dist-packages/hachoir_core/stream/input_helper.py 28597
+usr/lib/python2.7/dist-packages/hachoir_core/stream/output.py 28596
+usr/lib/python2.7/dist-packages/hachoir_core/field/bit_field.py 28595
+usr/lib/python2.7/dist-packages/hachoir_core/field/byte_field.py 28594
+usr/lib/python2.7/dist-packages/hachoir_core/field/sub_file.py 28593
+usr/lib/python2.7/dist-packages/hachoir_core/field/character.py 28592
+usr/lib/python2.7/dist-packages/hachoir_core/field/integer.py 28591
+usr/lib/i386-linux-gnu/i686/sse2/libx264.so.142 28590
+usr/lib/python2.7/dist-packages/hachoir_core/field/enum.py 28589
+usr/lib/python2.7/dist-packages/hachoir_core/field/string_field.py 28588
+usr/lib/python2.7/dist-packages/hachoir_core/field/padding.py 28587
+usr/lib/python2.7/dist-packages/hachoir_core/field/helper.py 28586
+usr/lib/python2.7/dist-packages/hachoir_core/field/fake_array.py 28585
+usr/lib/python2.7/dist-packages/hachoir_core/field/basic_field_set.py 28584
+usr/lib/python2.7/dist-packages/hachoir_core/event_handler.py 28583
+usr/lib/python2.7/dist-packages/hachoir_core/field/generic_field_set.py 28582
+usr/lib/python2.7/dist-packages/hachoir_core/dict.py 28581
+usr/lib/python2.7/dist-packages/hachoir_core/field/seekable_field_set.py 28580
+usr/lib/i386-linux-gnu/libvpx.so.1.3.0 28579
+usr/lib/python2.7/dist-packages/hachoir_core/field/field_set.py 28578
+usr/lib/python2.7/dist-packages/hachoir_core/field/static_field_set.py 28577
+usr/lib/python2.7/dist-packages/hachoir_core/field/parser.py 28576
+usr/lib/python2.7/dist-packages/hachoir_core/field/vector.py 28575
+usr/lib/python2.7/dist-packages/hachoir_core/field/float.py 28574
+usr/lib/python2.7/dist-packages/hachoir_core/field/timestamp.py 28573
+usr/lib/python2.7/dist-packages/hachoir_core/field/link.py 28572
+usr/lib/python2.7/dist-packages/hachoir_parser/parser_list.py 28571
+usr/lib/python2.7/dist-packages/hachoir_parser/guess.py 28570
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/__init__.py 28569
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/ace.py 28568
+usr/lib/python2.7/dist-packages/hachoir_core/text_handler.py 28567
+usr/lib/python2.7/dist-packages/hachoir_parser/common/__init__.py 28566
+usr/lib/python2.7/dist-packages/hachoir_parser/common/msdos.py 28565
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/ar.py 28564
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/bzip2_parser.py 28563
+usr/lib/python2.7/lib-dynload/bz2.i386-linux-gnu.so 28562
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/cab.py 28561
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/gzip_parser.py 28560
+usr/lib/python2.7/dist-packages/hachoir_parser/common/deflate.py 28559
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/tar.py 28558
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/zip.py 28557
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/rar.py 28556
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/rpm.py 28555
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/sevenzip.py 28554
+usr/share/fonts/truetype/arphic/ukai.ttc 28553
+usr/lib/i386-linux-gnu/libtheoraenc.so.1.1.2 28552
+usr/lib/python2.7/dist-packages/hachoir_parser/archive/mar.py 28551
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/__init__.py 28550
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/aiff.py 28549
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/id3.py 28548
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/au.py 28547
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/itunesdb.py 28546
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/midi.py 28545
+usr/lib/python2.7/dist-packages/hachoir_parser/common/tracker.py 28544
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/mpeg_audio.py 28543
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/real_audio.py 28542
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/xm.py 28541
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/modplug.py 28540
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/s3m.py 28539
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/mod.py 28538
+usr/lib/python2.7/dist-packages/hachoir_parser/audio/flac.py 28537
+usr/lib/python2.7/dist-packages/hachoir_parser/container/__init__.py 28536
+usr/lib/python2.7/dist-packages/hachoir_parser/container/asn1.py 28535
+usr/lib/python2.7/dist-packages/hachoir_parser/container/mkv.py 28534
+usr/lib/python2.7/dist-packages/hachoir_core/iso639.py 28533
+usr/lib/python2.7/dist-packages/hachoir_parser/container/ogg.py 28532
+usr/lib/python2.7/dist-packages/hachoir_parser/container/riff.py 28531
+usr/lib/python2.7/dist-packages/hachoir_parser/video/__init__.py 28530
+usr/lib/python2.7/dist-packages/hachoir_parser/video/asf.py 28529
+usr/lib/python2.7/dist-packages/hachoir_parser/video/fourcc.py 28528
+usr/lib/python2.7/dist-packages/hachoir_parser/common/win32.py 28527
+usr/lib/python2.7/dist-packages/hachoir_parser/network/__init__.py 28526
+usr/lib/python2.7/dist-packages/hachoir_parser/network/tcpdump.py 28525
+usr/lib/python2.7/dist-packages/hachoir_parser/network/common.py 28524
+usr/lib/python2.7/dist-packages/hachoir_parser/network/ouid.py 28523
+usr/lib/i386-linux-gnu/libtheoradec.so.1.1.4 28522
+usr/lib/i386-linux-gnu/sse2/libspeex.so.1.5.0 28521
+usr/lib/i386-linux-gnu/libschroedinger-1.0.so.0.11.0 28520
+usr/lib/i386-linux-gnu/libopus.so.0.5.0 28519
+usr/lib/i386-linux-gnu/libopenjpeg.so.1.5.2 28518
+usr/lib/python2.7/dist-packages/hachoir_parser/video/flv.py 28517
+usr/lib/python2.7/dist-packages/hachoir_parser/video/amf.py 28516
+usr/lib/python2.7/dist-packages/hachoir_parser/video/mov.py 28515
+usr/lib/python2.7/dist-packages/hachoir_parser/video/mpeg_video.py 28514
+usr/lib/i386-linux-gnu/libmp3lame.so.0.0.0 28513
+usr/lib/python2.7/dist-packages/hachoir_parser/video/mpeg_ts.py 28512
+usr/lib/python2.7/dist-packages/hachoir_parser/image/__init__.py 28511
+usr/lib/python2.7/dist-packages/hachoir_parser/image/bmp.py 28510
+usr/lib/python2.7/dist-packages/hachoir_parser/image/common.py 28509
+usr/lib/python2.7/dist-packages/hachoir_parser/image/gif.py 28508
+usr/lib/python2.7/dist-packages/hachoir_parser/image/ico.py 28507
+usr/lib/python2.7/dist-packages/hachoir_parser/image/jpeg.py 28506
+usr/lib/python2.7/dist-packages/hachoir_parser/image/exif.py 28505
+usr/lib/python2.7/dist-packages/hachoir_parser/image/photoshop_metadata.py 28504
+usr/lib/python2.7/dist-packages/hachoir_parser/image/iptc.py 28503
+usr/lib/python2.7/dist-packages/hachoir_parser/image/pcx.py 28502
+usr/lib/python2.7/dist-packages/hachoir_parser/image/psd.py 28501
+usr/lib/python2.7/dist-packages/hachoir_parser/image/png.py 28500
+usr/lib/python2.7/dist-packages/hachoir_parser/image/tga.py 28499
+usr/lib/python2.7/dist-packages/hachoir_parser/image/tiff.py 28498
+usr/lib/python2.7/dist-packages/hachoir_parser/image/wmf.py 28497
+usr/lib/python2.7/dist-packages/hachoir_parser/image/xcf.py 28496
+usr/lib/python2.7/dist-packages/hachoir_parser/container/swf.py 28495
+usr/lib/python2.7/dist-packages/hachoir_parser/container/action_script.py 28494
+usr/lib/python2.7/dist-packages/hachoir_parser/container/realmedia.py 28493
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/__init__.py 28492
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/ext2.py 28491
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/fat.py 28490
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/mbr.py 28489
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/ntfs.py 28488
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/iso9660.py 28487
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/reiser_fs.py 28486
+usr/lib/i386-linux-gnu/libgsm.so.1.0.12 28485
+usr/lib/i386-linux-gnu/libva.so.1.3600.0 28484
+usr/lib/python2.7/dist-packages/hachoir_parser/file_system/linux_swap.py 28483
+usr/lib/python2.7/dist-packages/hachoir_parser/game/__init__.py 28482
+usr/lib/python2.7/dist-packages/hachoir_parser/game/zsnes.py 28481
+usr/lib/python2.7/dist-packages/hachoir_parser/game/spider_man_video.py 28480
+usr/lib/python2.7/dist-packages/hachoir_parser/game/laf.py 28479
+usr/lib/python2.7/dist-packages/hachoir_parser/game/blp.py 28478
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/__init__.py 28477
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/file_3do.py 28476
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/common.py 28475
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/file_3ds.py 28474
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/torrent.py 28473
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/ttf.py 28472
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/chm.py 28471
+usr/lib/python2.7/dist-packages/hachoir_parser/common/win32_lang_id.py 28470
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/lnk.py 28469
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/pcf.py 28468
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/ole2.py 28467
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/msoffice.py 28466
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/msoffice_summary.py 28465
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/word_doc.py 28464
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/pdf.py 28463
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/pifv.py 28462
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/hlp.py 28461
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/gnome_keyring.py 28460
+usr/lib/python2.7/dist-packages/hachoir_parser/misc/bplist.py 28459
+usr/lib/python2.7/dist-packages/hachoir_parser/program/__init__.py 28458
+usr/lib/python2.7/dist-packages/hachoir_parser/program/elf.py 28457
+usr/lib/python2.7/dist-packages/hachoir_parser/program/exe.py 28456
+usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_ne.py 28455
+usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_pe.py 28454
+usr/lib/python2.7/dist-packages/hachoir_parser/program/exe_res.py 28453
+usr/lib/python2.7/dist-packages/hachoir_parser/program/python.py 28452
+usr/lib/python2.7/dist-packages/hachoir_parser/program/java.py 28451
+usr/lib/python2.7/dist-packages/hachoir_parser/program/prc.py 28450
+usr/lib/python2.7/dist-packages/MAT/exceptions.py 28449
+usr/lib/python2.7/dist-packages/MAT/strippers.py 28448
+usr/lib/python2.7/dist-packages/MAT/archive.py 28447
+usr/lib/python2.7/tarfile.py 28446
+usr/lib/python2.7/dist-packages/MAT/parser.py 28445
+usr/lib/python2.7/dist-packages/MAT/hachoir_editor/__init__.py 28444
+usr/lib/python2.7/dist-packages/MAT/hachoir_editor/field.py 28443
+usr/lib/python2.7/dist-packages/MAT/hachoir_editor/typed_field.py 28442
+usr/lib/python2.7/dist-packages/MAT/hachoir_editor/fieldset.py 28441
+usr/lib/python2.7/dist-packages/MAT/audio.py 28440
+usr/lib/python2.7/dist-packages/mutagen/__init__.py 28439
+usr/lib/python2.7/dist-packages/mutagen/_util.py 28438
+usr/lib/python2.7/dist-packages/mutagen/_compat.py 28437
+usr/lib/python2.7/StringIO.py 28436
+usr/lib/python2.7/dist-packages/mutagen/_file.py 28435
+usr/lib/python2.7/dist-packages/mutagen/_tags.py 28434
+usr/lib/python2.7/dist-packages/mutagen/flac.py 28433
+usr/lib/python2.7/dist-packages/mutagen/_vorbis.py 28432
+usr/share/tor/geoip6 28431
+usr/lib/python2.7/dist-packages/mutagen/id3/__init__.py 28430
+usr/lib/python2.7/dist-packages/mutagen/id3/_util.py 28429
+usr/lib/python2.7/dist-packages/mutagen/id3/_frames.py 28428
+usr/lib/python2.7/dist-packages/mutagen/id3/_specs.py 28427
+usr/lib/python2.7/dist-packages/mutagen/_constants.py 28426
+usr/lib/python2.7/dist-packages/mutagen/oggvorbis.py 28425
+usr/lib/python2.7/dist-packages/mutagen/ogg.py 28424
+usr/lib/python2.7/dist-packages/MAT/mutagenstripper.py 28423
+usr/lib/python2.7/dist-packages/MAT/images.py 28422
+usr/lib/python2.7/dist-packages/MAT/misc.py 28421
+usr/lib/python2.7/dist-packages/MAT/bencode/__init__.py 28420
+usr/lib/python2.7/dist-packages/MAT/bencode/bencode.py 28419
+usr/lib/python2.7/dist-packages/MAT/office.py 28418
+usr/share/pyshared/cairo/__init__.py 28417
+usr/lib/pyshared/python2.7/cairo/_cairo.so 28416
+usr/lib/girepository-1.0/Poppler-0.18.typelib 28415
+usr/bin/exiftool 28414
+usr/share/perl5/Image/ExifTool.pm 28413
+usr/share/perl5/File/RandomAccess.pm 28412
+usr/share/perl5/Image/ExifTool/Exif.pm 28411
+usr/share/perl5/Image/ExifTool/MakerNotes.pm 28410
+usr/lib/python2.7/dist-packages/MAT/exiftool.py 28409
+usr/share/nautilus-python/extensions/onionshare-nautilus.py 28408
+usr/lib/nautilus/extensions-3.0/libnautilus-seahorse.so 28407
+usr/lib/nautilus/extensions-3.0/libnautilus-sendto.so 28406
+usr/lib/nautilus/extensions-3.0/libnautilus-wipe.so 28405
+usr/lib/libgsecuredelete.so.0.0.0 28404
+usr/lib/nautilus/extensions-3.0/libterminal-nautilus.so 28403
+usr/lib/nautilus/extensions-3.0/libtotem-properties-page.so 28402
+usr/lib/gvfs/gvfsd-trash 28401
+usr/share/perl/5.20.2/feature.pm 28400
+usr/share/icons/Adwaita/scalable/actions/list-add-symbolic.svg 28399
+usr/share/icons/Adwaita/cursors/top_left_corner 28398
+usr/share/icons/Adwaita/cursors/top_side 28397
+usr/share/icons/Adwaita/cursors/top_right_corner 28396
+usr/share/icons/Adwaita/cursors/left_side 28395
+usr/share/icons/Adwaita/cursors/right_side 28394
+usr/share/icons/Adwaita/cursors/bottom_left_corner 28393
+usr/share/icons/Adwaita/cursors/bottom_side 28392
+usr/share/icons/Adwaita/cursors/bottom_right_corner 28391
+usr/share/fonts/truetype/unifont/unifont.ttf 28390
+usr/share/icons/Adwaita/22x22/apps/system-file-manager.png 28389
+usr/share/icons/Adwaita/16x16/apps/system-file-manager.png 28388
+usr/share/icons/Adwaita/24x24/apps/system-file-manager.png 28387
+usr/share/icons/Adwaita/32x32/apps/system-file-manager.png 28386
+usr/share/icons/Adwaita/256x256/apps/system-file-manager.png 28385
+usr/share/icons/Adwaita/48x48/apps/system-file-manager.png 28384
+usr/lib/gvfs/gvfsd-burn 28383
+usr/share/icons/gnome/16x16/actions/edit-clear.png 28382
+usr/share/icons/Adwaita/16x16/apps/utilities-terminal.png 28381
+usr/share/icons/Adwaita/cursors/sb_h_double_arrow 28380
+usr/share/icons/Adwaita/48x48/places/user-home.png 28379
+usr/bin/inotifywait 28378
+usr/share/pixmaps/whisperback.svg 28377
+usr/share/icons/gnome/48x48/categories/system-help.png 28376
+usr/share/icons/Adwaita/48x48/places/user-trash.png 28375
+usr/lib/gvfs/gvfsd-metadata 28374
+usr/lib/libinotifytools.so.0.4.1 28373
+usr/bin/sort 28372
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstclutter.so 28371
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcoloreffects.so 28370
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcompositor.so 28369
+usr/lib/i386-linux-gnu/libgstbadvideo-1.0.so.0.404.0 28368
+usr/lib/i386-linux-gnu/libgstbadbase-1.0.so.0.404.0 28367
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcoreelements.so 28366
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcurl.so 28365
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstcutter.so 28364
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdashdemux.so 28363
+usr/lib/i386-linux-gnu/libgsturidownloader-1.0.so.0.404.0 28362
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdataurisrc.so 28361
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdebug.so 28360
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdebugutilsbad.so 28359
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdecklink.so 28358
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdeinterlace.so 28357
+usr/share/fonts/truetype/dejavu/DejaVuSansMono-Bold.ttf 28356
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdtmf.so 28355
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdtsdec.so 28354
+usr/lib/i386-linux-gnu/libdca.so.0.0.0 28353
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdv.so 28352
+usr/lib/i386-linux-gnu/libdv.so.4.0.3 28351
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvb.so 28350
+usr/lib/i386-linux-gnu/libgstmpegts-1.0.so.0.404.0 28349
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvbsuboverlay.so 28348
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdlpcmdec.so 28347
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdread.so 28346
+usr/lib/i386-linux-gnu/libdvdread.so.4.1.2 28345
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdspu.so 28344
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstdvdsub.so 28343
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsteffectv.so 28342
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstencodebin.so 28341
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstequalizer.so 28340
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfaad.so 28339
+usr/lib/i386-linux-gnu/libfaad.so.2.0.0 28338
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfbdevsink.so 28337
+usr/share/icons/hicolor/64x64/apps/icedove.png 28336
+usr/share/icons/hicolor/scalable/apps/pidgin.svg 28335
+usr/share/icons/hicolor/64x64/apps/keepassx.png 28334
+usr/share/icons/Adwaita/256x256/apps/utilities-terminal.png 28333
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfestival.so 28332
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfieldanalysis.so 28331
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflac.so 28330
+usr/share/icons/gnome/24x24/status/dialog-information.png 28329
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflite.so 28328
+usr/lib/i386-linux-gnu/libflite.so.1.4 28327
+usr/lib/i386-linux-gnu/libflite_cmu_us_kal.so.1.4 28326
+lib/systemd/system/htpdate.service 28325
+etc/default/htpdate.pools 28324
+etc/default/htpdate.user-agent 28323
+usr/share/icons/Adwaita/scalable/devices/network-wired-symbolic.svg 28322
+usr/share/icons/gnome/48x48/status/dialog-information.png 28321
+usr/lib/i386-linux-gnu/libflite_usenglish.so.1.4 28320
+usr/share/gnome-shell/theme/message-tray-background.png 28319
+usr/share/gnome-shell/theme/summary-counter.svg 28318
+usr/lib/i386-linux-gnu/libflite_cmulex.so.1.4 28316
+usr/local/bin/tails-security-check 28315
+usr/local/bin/tails-upgrade-frontend-wrapper 28314
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfluidsynthmidi.so 28313
+usr/share/perl5/Carp/Assert/More.pm 28312
+usr/share/perl5/Carp/Assert.pm 28311
+usr/lib/i386-linux-gnu/libfluidsynth.so.1.5.2 28310
+usr/local/sbin/htpdate 28309
+usr/share/perl5/Tails/Download/HTTPS.pm 28308
+usr/lib/i386-linux-gnu/perl5/5.20/Moose.pm 28307
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Deprecated.pm 28306
+usr/share/perl5/Package/DeprecationManager.pm 28305
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Exporter.pm 28304
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP.pm 28303
+usr/share/perl5/DateTime/Format/DateParse.pm 28302
+usr/share/perl5/Date/Parse.pm 28301
+usr/share/perl/5.20.2/Time/Local.pm 28300
+usr/share/perl5/Time/Zone.pm 28299
+usr/share/perl5/Getopt/Long/Descriptive.pm 28298
+usr/share/perl5/Getopt/Long/Descriptive/Opts.pm 28297
+usr/share/perl5/Getopt/Long/Descriptive/Usage.pm 28296
+usr/share/perl5/Sub/Exporter/Util.pm 28295
+usr/share/perl5/Sub/Exporter.pm 28294
+usr/share/perl5/MRO/Compat.pm 28293
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/AttributeCore.pm 28292
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin.pm 28291
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/HasAttributes.pm 28290
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Mixin/HasMethods.pm 28289
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Meta.pm 28288
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method.pm 28287
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Object.pm 28286
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Overload.pm 28285
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Class.pm 28284
+usr/share/icons/hicolor/scalable/status/tor-connected-symbolic.svg 28283
+usr/lib/i386-linux-gnu/libjack.so.0.1.0 28282
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Instance.pm 28281
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Wrapped.pm 28280
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Accessor.pm 28279
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Generated.pm 28278
+usr/share/perl5/Eval/Closure.pm 28277
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Constructor.pm 28276
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Method/Inlined.pm 28275
+usr/share/perl/5.20.2/open.pm 28274
+usr/lib/i386-linux-gnu/perl/5.20.2/threads.pm 28273
+usr/lib/i386-linux-gnu/libpulse-simple.so.0.1.0 28272
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/threads/threads.so 28271
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/MiniTrait.pm 28270
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Module.pm 28269
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Package.pm 28268
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflv.so 28267
+usr/bin/curl 28266
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Attribute.pm 28265
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Moose/Moose.so 28264
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Deprecated.pm 28263
+usr/lib/i386-linux-gnu/perl5/5.20/Class/MOP/Class/Immutable/Trait.pm 28262
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/MetaRole.pm 28261
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util.pm 28260
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Class.pm 28259
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstflxdec.so 28258
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Overridden.pm 28257
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method.pm 28256
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Object/Trait.pm 28255
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Augmented.pm 28254
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Class/Immutable/Trait.pm 28253
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Constructor.pm 28252
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Destructor.pm 28251
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Meta.pm 28250
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint.pm 28249
+usr/lib/i386-linux-gnu/perl5/5.20/metaclass.pm 28248
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeCoercion.pm 28247
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute.pm 28246
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor.pm 28245
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfragmented.so 28244
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfreeverb.so 28243
+usr/lib/i386-linux-gnu/libcurl.so.4.3.0 28242
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Delegation.pm 28241
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/TypeConstraints.pm 28240
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Union.pm 28239
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeCoercion/Union.pm 28238
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Parameterized.pm 28237
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Parameterizable.pm 28236
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Class.pm 28235
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Role.pm 28234
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Enum.pm 28233
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/DuckType.pm 28232
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/TypeConstraint/Registry.pm 28231
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Util/TypeConstraints/Builtins.pm 28230
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Mixin/AttributeCore.pm 28229
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Instance.pm 28228
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Object.pm 28227
+usr/share/perl/5.20.2/if.pm 28226
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role.pm 28225
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstfrei0r.so 28224
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgaudieffects.so 28223
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgdkpixbuf.so 28222
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Attribute.pm 28221
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgdp.so 28220
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgeometrictransform.so 28219
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method.pm 28218
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method/Required.pm 28217
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Method/Conflicting.pm 28216
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgio.so 28215
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Composite.pm 28214
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgme.so 28213
+usr/lib/libgme.so.0.5.3 28212
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application.pm 28211
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/RoleSummation.pm 28210
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToClass.pm 28209
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToRole.pm 28208
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Role/Application/ToInstance.pm 28207
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native.pm 28206
+usr/share/perl5/MooseX/Method/Signatures.pm 28205
+usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare.pm 28204
+usr/lib/i386-linux-gnu/perl5/5.20/B/Hooks/OP/Check.pm 28203
+usr/lib/i386-linux-gnu/perl5/5.20/auto/B/Hooks/OP/Check/Check.so 28202
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgoom.so 28201
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgoom2k1.so 28200
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstgsm.so 28199
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsticydemux.so 28198
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstid3demux.so 28197
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstid3tag.so 28196
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Devel/Declare/Declare.so 28195
+usr/share/perl5/MooseX/LazyRequire.pm 28194
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstimagefreeze.so 28193
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinter.so 28192
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinterlace.so 28191
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstinterleave.so 28190
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstisomp4.so 28189
+usr/share/perl5/aliased.pm 28188
+usr/share/perl5/MooseX/LazyRequire/Meta/Attribute/Trait/LazyRequire.pm 28187
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Role.pm 28186
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstivfparse.so 28185
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstivtc.so 28184
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjack.so 28183
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjp2kdecimator.so 28182
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjpeg.so 28181
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstjpegformat.so 28180
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstkate.so 28179
+usr/share/perl5/MooseX/Types/Moose.pm 28178
+usr/lib/libkate.so.1.3.0 28177
+usr/share/perl5/MooseX/Types.pm 28176
+usr/share/perl5/MooseX/Types/TypeDecorator.pm 28175
+usr/share/perl5/Carp/Clan.pm 28174
+usr/share/perl5/MooseX/Types/Base.pm 28173
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstladspa.so 28172
+usr/share/perl5/MooseX/Types/Util.pm 28171
+usr/share/perl5/MooseX/Types/UndefinedType.pm 28170
+usr/share/perl5/MooseX/Types/CheckedUtilExports.pm 28169
+usr/share/perl5/MooseX/Method/Signatures/Meta/Method.pm 28168
+usr/share/perl5/Context/Preserve.pm 28167
+usr/share/perl5/Parse/Method/Signatures.pm 28166
+usr/share/perl5/PPI.pm 28165
+usr/share/perl5/PPI/Util.pm 28164
+usr/lib/i386-linux-gnu/perl/5.20.2/Digest/MD5.pm 28163
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Digest/MD5/MD5.so 28162
+usr/share/perl5/PPI/Exception.pm 28161
+usr/share/perl5/PPI/Element.pm 28160
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlame.so 28159
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlevel.so 28158
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlibav.so 28157
+usr/lib/i386-linux-gnu/perl5/5.20/Clone.pm 28156
+usr/lib/i386-linux-gnu/i686/cmov/libavformat.so.56.1.0 28155
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Clone/Clone.so 28154
+usr/share/perl5/PPI/Node.pm 28153
+usr/share/perl5/PPI/Token.pm 28152
+usr/share/perl5/PPI/Token/BOM.pm 28151
+usr/share/perl5/PPI/Token/Whitespace.pm 28150
+usr/share/perl5/PPI/Token/Comment.pm 28149
+usr/share/perl5/PPI/Token/Pod.pm 28148
+usr/share/perl5/PPI/Token/Number.pm 28147
+usr/share/perl5/PPI/Token/Number/Binary.pm 28146
+usr/share/perl5/PPI/Token/Number/Octal.pm 28145
+usr/share/perl5/PPI/Token/Number/Hex.pm 28144
+usr/share/perl5/PPI/Token/Number/Float.pm 28143
+usr/share/perl5/PPI/Token/Number/Exp.pm 28142
+usr/share/perl5/PPI/Token/Number/Version.pm 28141
+usr/share/perl5/PPI/Token/Word.pm 28140
+usr/share/perl5/PPI/Token/DashedWord.pm 28139
+usr/share/perl5/PPI/Token/Symbol.pm 28138
+usr/share/perl5/PPI/Token/ArrayIndex.pm 28137
+usr/share/perl5/PPI/Token/Magic.pm 28136
+usr/share/perl5/PPI/Token/Unknown.pm 28135
+usr/share/perl5/PPI/Token/Quote/Single.pm 28134
+usr/share/perl5/PPI/Token/Quote.pm 28133
+usr/share/perl5/PPI/Token/_QuoteEngine/Simple.pm 28132
+usr/share/perl5/PPI/Token/_QuoteEngine.pm 28131
+usr/share/perl5/PPI/Token/Quote/Double.pm 28130
+usr/share/perl5/PPI/Token/Quote/Literal.pm 28129
+usr/share/perl5/PPI/Token/_QuoteEngine/Full.pm 28128
+usr/share/perl5/PPI/Token/Quote/Interpolate.pm 28127
+usr/share/perl5/PPI/Token/QuoteLike/Backtick.pm 28126
+usr/share/perl5/PPI/Token/QuoteLike.pm 28125
+usr/share/perl5/PPI/Token/QuoteLike/Command.pm 28124
+usr/share/perl5/PPI/Token/QuoteLike/Regexp.pm 28123
+usr/share/perl5/PPI/Token/QuoteLike/Words.pm 28122
+usr/share/perl5/PPI/Token/QuoteLike/Readline.pm 28121
+usr/share/perl5/PPI/Token/Regexp/Match.pm 28120
+usr/share/perl5/PPI/Token/Regexp.pm 28119
+usr/share/perl5/PPI/Token/Regexp/Substitute.pm 28118
+usr/share/perl5/PPI/Token/Regexp/Transliterate.pm 28117
+usr/share/perl5/PPI/Token/Operator.pm 28116
+usr/share/perl5/PPI/Token/Cast.pm 28115
+usr/share/perl5/PPI/Token/Structure.pm 28114
+usr/share/perl5/PPI/Token/Label.pm 28113
+usr/share/perl5/PPI/Token/HereDoc.pm 28112
+usr/share/perl5/PPI/Token/Separator.pm 28111
+usr/share/perl5/PPI/Token/Data.pm 28110
+usr/share/perl5/IO/String.pm 28109
+usr/share/perl5/PPI/Token/End.pm 28108
+usr/share/perl5/PPI/Token/Prototype.pm 28107
+usr/share/perl5/PPI/Token/Attribute.pm 28106
+usr/share/perl5/PPI/Statement.pm 28105
+usr/share/perl5/PPI/Statement/Break.pm 28104
+usr/share/perl5/PPI/Statement/Compound.pm 28103
+usr/share/perl5/PPI/Statement/Data.pm 28102
+usr/share/perl5/PPI/Statement/End.pm 28101
+usr/share/perl5/PPI/Statement/Expression.pm 28100
+usr/share/perl5/PPI/Statement/Include.pm 28099
+usr/share/perl5/PPI/Statement/Include/Perl6.pm 28098
+usr/share/perl5/PPI/Statement/Null.pm 28097
+usr/share/perl5/PPI/Statement/Package.pm 28096
+usr/share/perl5/PPI/Statement/Scheduled.pm 28095
+usr/share/perl5/PPI/Statement/Sub.pm 28094
+usr/share/perl5/PPI/Statement/Given.pm 28093
+usr/share/perl5/PPI/Statement/UnmatchedBrace.pm 28092
+usr/share/perl5/PPI/Statement/Unknown.pm 28091
+usr/share/perl5/PPI/Statement/Variable.pm 28090
+usr/share/perl5/PPI/Statement/When.pm 28089
+usr/share/perl5/PPI/Structure.pm 28088
+usr/share/perl5/PPI/Structure/Block.pm 28087
+usr/share/perl5/PPI/Structure/Condition.pm 28086
+usr/share/perl5/PPI/Structure/Constructor.pm 28085
+usr/share/perl5/PPI/Structure/For.pm 28084
+usr/share/perl5/PPI/Structure/Given.pm 28083
+usr/share/perl5/PPI/Structure/List.pm 28082
+usr/share/perl5/PPI/Structure/Subscript.pm 28081
+usr/share/perl5/PPI/Structure/Unknown.pm 28080
+usr/share/perl5/PPI/Structure/When.pm 28079
+usr/share/perl5/PPI/Document.pm 28078
+usr/share/perl5/PPI/Exception/ParserTimeout.pm 28077
+usr/share/perl5/PPI/Document/Fragment.pm 28076
+usr/share/perl5/PPI/Document/File.pm 28075
+usr/share/perl5/PPI/Document/Normalized.pm 28074
+usr/share/perl5/PPI/Normal.pm 28073
+usr/share/perl5/PPI/Normal/Standard.pm 28072
+usr/share/perl5/PPI/Tokenizer.pm 28071
+usr/share/perl5/PPI/Exception/ParserRejection.pm 28070
+usr/share/perl5/PPI/Lexer.pm 28069
+usr/share/perl5/Parse/Method/Signatures/ParamCollection.pm 28068
+usr/share/perl5/Parse/Method/Signatures/Types.pm 28067
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstlibvisual.so 28066
+usr/lib/i386-linux-gnu/libvisual-0.4.so.0.0.0 28065
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstliveadder.so 28064
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmad.so 28063
+usr/lib/i386-linux-gnu/libmad.so.0.2.1 28062
+usr/share/perl5/Parse/Method/Signatures/TypeConstraint.pm 28061
+usr/share/perl5/MooseX/Meta/TypeConstraint/ForceCoercion.pm 28060
+usr/share/perl5/MooseX/Types/Structured.pm 28059
+usr/share/perl5/MooseX/Meta/TypeConstraint/Structured.pm 28058
+usr/share/perl5/Devel/PartialDump.pm 28057
+usr/share/perl5/Class/Tiny.pm 28056
+usr/share/perl/5.20.2/unicore/lib/Perl/Print.pl 28055
+usr/share/perl5/MooseX/Meta/TypeCoercion/Structured.pm 28054
+usr/share/ca-certificates/mozilla/AddTrust_External_Root.crt 28053
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmatroska.so 28052
+usr/share/perl5/MooseX/Meta/TypeConstraint/Structured/Optional.pm 28051
+usr/share/perl5/MooseX/Meta/TypeCoercion/Structured/Optional.pm 28050
+usr/share/perl5/MooseX/Types/Structured/OverflowHandler.pm 28049
+usr/share/perl5/MooseX/Types/Structured/MessageStack.pm 28048
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait/Counter.pm 28047
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait.pm 28046
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Counter/dec.pm 28045
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Writer.pm 28044
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native.pm 28043
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Counter/inc.pm 28042
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Attribute/Native/Trait/Array.pm 28041
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/elements.pm 28040
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Reader.pm 28039
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/push.pm 28038
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/Writer.pm 28037
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array.pm 28036
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Collection.pm 28035
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/count.pm 28034
+usr/share/ca-certificates/mozilla/VeriSign_Class_3_Public_Primary_Certification_Authority_-_G5.crt 28033
+usr/share/perl5/MooseX/Method/Signatures/Types.pm 28032
+usr/share/perl5/Parse/Method/Signatures/Param/Named.pm 28031
+usr/share/perl5/Parse/Method/Signatures/Param/Placeholder.pm 28030
+usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare/Context/Simple.pm 28029
+usr/share/perl5/MooseX/Has/Sugar/Saccharin.pm 28028
+usr/share/perl/5.20.2/autodie.pm 28027
+usr/share/perl/5.20.2/autodie/exception/system.pm 28026
+usr/share/perl/5.20.2/autodie/exception.pm 28025
+usr/lib/i386-linux-gnu/perl5/5.20/WWW/Curl/Easy.pm 28024
+usr/lib/i386-linux-gnu/perl5/5.20/WWW/Curl.pm 28023
+usr/lib/i386-linux-gnu/perl5/5.20/auto/WWW/Curl/Curl.so 28022
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmidi.so 28021
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmimic.so 28020
+usr/lib/libmimic.so.0.0.1 28019
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmms.so 28018
+usr/lib/i386-linux-gnu/libmms.so.0.0.2 28017
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmodplug.so 28016
+usr/lib/libmodplug.so.1.0.0 28015
+usr/share/perl5/Parse/Method/Signatures/Sig.pm 28014
+usr/share/perl5/Parse/Method/Signatures/Param.pm 28013
+usr/share/perl5/MooseX/Traits.pm 28012
+usr/share/perl5/MooseX/Traits/Util.pm 28011
+usr/share/perl5/Parse/Method/Signatures/Param/Positional.pm 28010
+usr/share/perl5/Parse/Method/Signatures/Param/Bindable.pm 28009
+usr/share/perl5/XML/Atom.pm 28008
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML.pm 28007
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Error.pm 28006
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmonoscope.so 28005
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpeg2dec.so 28004
+usr/lib/i386-linux-gnu/libmpeg2.so.0.1.0 28003
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/NodeList.pm 28002
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Boolean.pm 28001
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Number.pm 28000
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/Literal.pm 27999
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/XPathContext.pm 27998
+usr/lib/i386-linux-gnu/perl5/5.20/auto/XML/LibXML/LibXML.so 27997
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpeg2enc.so 27996
+usr/lib/i386-linux-gnu/libmjpegutils-2.1.so.0.0.0 27995
+usr/lib/i386-linux-gnu/libmpeg2encpp-2.1.so.0.0.0 27994
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegpsdemux.so 27993
+usr/lib/i386-linux-gnu/perl5/5.20/XML/LibXML/AttributeHash.pm 27992
+usr/share/perl5/XML/SAX/Exception.pm 27991
+usr/share/perl5/XML/Atom/ErrorHandler.pm 27990
+usr/share/perl5/XML/Atom/Feed.pm 27989
+usr/share/perl5/XML/Atom/Thing.pm 27988
+usr/share/perl5/XML/Atom/Base.pm 27987
+usr/share/perl5/Class/Data/Inheritable.pm 27986
+usr/share/perl5/XML/Atom/Util.pm 27985
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegpsmux.so 27984
+usr/share/perl5/XML/Atom/Category.pm 27983
+usr/share/perl5/XML/Atom/Link.pm 27982
+usr/share/perl5/LWP/UserAgent.pm 27981
+usr/share/perl5/HTTP/Request.pm 27980
+usr/share/perl5/HTTP/Message.pm 27979
+usr/share/perl5/HTTP/Headers.pm 27978
+usr/lib/i386-linux-gnu/perl/5.20.2/Storable.pm 27977
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegtsdemux.so 27976
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Storable/Storable.so 27975
+usr/lib/i386-linux-gnu/libgstcodecparsers-1.0.so.0.404.0 27974
+usr/share/perl5/HTTP/Response.pm 27973
+usr/share/perl5/HTTP/Status.pm 27972
+usr/share/perl5/HTTP/Date.pm 27971
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpegtsmux.so 27970
+usr/share/perl5/LWP.pm 27969
+usr/share/perl5/LWP/Protocol.pm 27968
+usr/share/perl5/LWP/MemberMixin.pm 27967
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmpg123.so 27966
+usr/share/perl5/XML/Atom/Entry.pm 27965
+usr/share/perl5/XML/Atom/Person.pm 27964
+usr/share/perl5/XML/Atom/Content.pm 27963
+usr/share/ca-certificates/mozilla/GlobalSign_Root_CA.crt 27962
+usr/lib/i386-linux-gnu/libmpg123.so.0.40.3 27961
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmplex.so 27960
+usr/lib/i386-linux-gnu/libmplex2-2.1.so.0.0.0 27959
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmulaw.so 27958
+usr/local/etc/ssl/certs/tails.boum.org-CA.pem 27957
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmultifile.so 27956
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmultipart.so 27955
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstmxf.so 27954
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstnavigationtest.so 27953
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstofa.so 27952
+usr/lib/libofa.so.0.0.0 27951
+usr/lib/i386-linux-gnu/libfftw3.so.3.4.4 27950
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstogg.so 27949
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenal.so 27948
+usr/lib/i386-linux-gnu/libopenal.so.1.15.1 27947
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopencv.so 27946
+usr/lib/i386-linux-gnu/libopencv_calib3d.so.2.4.9 27945
+usr/lib/i386-linux-gnu/libopencv_contrib.so.2.4.9 27944
+usr/share/ca-certificates/mozilla/Verisign_Class_3_Public_Primary_Certification_Authority.crt 27943
+usr/lib/i386-linux-gnu/libopencv_core.so.2.4.9 27942
+usr/lib/i386-linux-gnu/libopencv_highgui.so.2.4.9 27941
+etc/NetworkManager/dispatcher.d/30-i2p.sh 27940
+etc/NetworkManager/dispatcher.d/60-tor-ready.sh 27939
+usr/local/sbin/tor-has-bootstrapped 27938
+usr/bin/gettext 27937
+usr/local/sbin/tails-notify-user 27936
+etc/NetworkManager/dispatcher.d/60-ttdnsd.sh 27935
+usr/sbin/service 27934
+usr/lib/i386-linux-gnu/libopencv_imgproc.so.2.4.9 27933
+etc/default/ttdnsd 27931
+usr/sbin/ttdnsd 27930
+usr/lib/libtsocks.so.1.8 27929
+etc/ttdnsd.conf 27928
+etc/NetworkManager/dispatcher.d/70-upgrade-additional-software.sh 27927
+usr/lib/i386-linux-gnu/libopencv_legacy.so.2.4.9 27926
+usr/lib/i386-linux-gnu/libopencv_objdetect.so.2.4.9 27925
+usr/lib/i386-linux-gnu/libopencv_video.so.2.4.9 27924
+usr/lib/i386-linux-gnu/libopencv_flann.so.2.4.9 27923
+usr/lib/i386-linux-gnu/libopencv_features2d.so.2.4.9 27922
+usr/lib/i386-linux-gnu/libGLU.so.1.3.1 27921
+usr/lib/libtbb.so.2 27920
+usr/lib/i386-linux-gnu/libopencv_ml.so.2.4.9 27919
+usr/lib/i386-linux-gnu/libjasper.so.1.0.0 27918
+usr/lib/i386-linux-gnu/libImath.so.6.0.0 27917
+usr/lib/i386-linux-gnu/libIlmImf.so.6.0.0 27916
+usr/lib/i386-linux-gnu/libIex.so.6.0.0 27915
+usr/lib/i386-linux-gnu/libHalf.so.6.0.0 27914
+usr/lib/i386-linux-gnu/libIlmThread.so.6.0.0 27913
+usr/lib/libgtkglext-x11-1.0.so.0.0.0 27912
+usr/lib/libgdkglext-x11-1.0.so.0.0.0 27911
+usr/lib/i386-linux-gnu/libXmu.so.6.2.0 27910
+usr/lib/i386-linux-gnu/libXt.so.6.0.0 27909
+usr/lib/i386-linux-gnu/libpangox-1.0.so.0.0.0 27908
+usr/lib/i386-linux-gnu/libdc1394.so.22.1.10 27907
+usr/lib/i386-linux-gnu/i686/cmov/libswscale.so.3.0.0 27906
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenexr.so 27905
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopengl.so 27904
+usr/lib/i386-linux-gnu/libgstgl-1.0.so.0.404.0 27903
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopenjpeg.so 27902
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstopus.so 27901
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstoss4audio.so 27900
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstossaudio.so 27899
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpango.so 27898
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpcapparse.so 27897
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstplayback.so 27896
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpng.so 27895
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstpnm.so 27894
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrawparse.so 27893
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstremovesilence.so 27892
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstreplaygain.so 27891
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstresindvd.so 27890
+usr/lib/i386-linux-gnu/libdvdnav.so.4.1.2 27889
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrfbsrc.so 27888
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrmdemux.so 27887
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrsvg.so 27886
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtmp.so 27885
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtp.so 27884
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtpmanager.so 27883
+usr/lib/i386-linux-gnu/libgstnet-1.0.so.0.404.0 27882
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstrtsp.so 27881
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsbc.so 27880
+usr/lib/i386-linux-gnu/libsbc.so.1.2.0 27879
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstschro.so 27878
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsdpelem.so 27877
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsegmentclip.so 27876
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshapewipe.so 27875
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshm.so 27874
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstshout2.so 27873
+usr/lib/i386-linux-gnu/libshout.so.3.2.0 27872
+usr/lib/i386-linux-gnu/libtheora.so.0.3.10 27871
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsid.so 27870
+usr/lib/libsidplay.so.1.0.3 27869
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsiren.so 27868
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmooth.so 27867
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmoothstreaming.so 27866
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsmpte.so 27865
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsndfile.so 27864
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsoundtouch.so 27863
+usr/lib/i386-linux-gnu/libSoundTouch.so.0.0.0 27862
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsouphttpsrc.so 27861
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspandsp.so 27860
+usr/lib/i386-linux-gnu/libspandsp.so.2.0.0 27859
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspectrum.so 27858
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspeed.so 27857
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstspeex.so 27856
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsrtp.so 27855
+usr/lib/libsrtp.so.0.0 27854
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgststereo.so 27853
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsubenc.so 27852
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstsubparse.so 27851
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttaglib.so 27850
+usr/lib/i386-linux-gnu/libtag.so.1.14.0 27849
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttcp.so 27848
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttheora.so 27847
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttwolame.so 27846
+usr/lib/libtwolame.so.0.0.0 27845
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsttypefindfunctions.so 27844
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstudp.so 27843
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstuvch264.so 27842
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideo4linux2.so 27841
+usr/lib/i386-linux-gnu/libgstallocators-1.0.so.0.404.0 27840
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideobox.so 27839
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoconvert.so 27838
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideocrop.so 27837
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideofilter.so 27836
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideofiltersbad.so 27835
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideomixer.so 27834
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoparsersbad.so 27833
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideorate.so 27832
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideoscale.so 27831
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideosignal.so 27830
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvideotestsrc.so 27829
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvmnc.so 27828
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvoaacenc.so 27827
+usr/lib/i386-linux-gnu/libvo-aacenc.so.0.0.4 27826
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvoamrwbenc.so 27825
+usr/lib/i386-linux-gnu/libvo-amrwbenc.so.0.0.4 27824
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvolume.so 27823
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvorbis.so 27822
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstvpx.so 27821
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavenc.so 27820
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavpack.so 27819
+usr/lib/i386-linux-gnu/libwavpack.so.1.1.5 27818
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwavparse.so 27817
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwaylandsink.so 27816
+usr/lib/i386-linux-gnu/libgstwayland-1.0.so.0.404.0 27815
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwebp.so 27814
+usr/lib/i386-linux-gnu/libwebp.so.5.0.1 27813
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstwildmidi.so 27812
+usr/lib/i386-linux-gnu/libWildMidi.so.1.1.2 27811
+etc/wildmidi/wildmidi.cfg 27810
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstx264.so 27809
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstximagesink.so 27808
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstximagesrc.so 27807
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstxingmux.so 27806
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstxvimagesink.so 27805
+usr/lib/i386-linux-gnu/libXv.so.1.0.0 27804
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsty4mdec.so 27803
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgsty4menc.so 27802
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstyadif.so 27801
+usr/lib/i386-linux-gnu/gstreamer-1.0/libgstzbar.so 27800
+usr/lib/libzbar.so.0.2.0 27799
+usr/share/florence/layouts/florence.xml 27798
+usr/share/florence/relaxng/florence.rng 27797
+usr/share/florence/styles/hard/florence.style 27796
+usr/share/florence/styles/hard/default.svg 27795
+usr/share/florence/styles/hard/tiny.svg 27794
+usr/share/florence/styles/hard/mini.svg 27793
+usr/share/florence/styles/hard/small.svg 27792
+usr/share/florence/styles/hard/wide.svg 27791
+usr/share/florence/styles/hard/xl.svg 27790
+usr/share/florence/styles/hard/xxl.svg 27789
+usr/share/florence/styles/hard/high.svg 27788
+usr/share/florence/styles/hard/space.svg 27787
+usr/share/florence/styles/hard/return.svg 27786
+usr/share/florence/styles/default/symbols.xml 27785
+usr/share/pixmaps/florence.svg 27784
+usr/share/florence/styles/default/sounds/sounds.xml 27783
+usr/share/florence/relaxng/style.rng 27782
+usr/share/florence/relaxng/svg11.rng 27781
+usr/share/florence/relaxng/svg-container-attrib.rng 27780
+usr/share/florence/relaxng/svg-viewport-attrib.rng 27779
+usr/share/florence/relaxng/svg-paint-attrib.rng 27778
+usr/share/florence/relaxng/svg-opacity-attrib.rng 27777
+usr/share/florence/relaxng/svg-graphics-attrib.rng 27776
+usr/share/florence/relaxng/svg-basic-graphics-attrib.rng 27775
+usr/share/florence/relaxng/svg-docevents-attrib.rng 27774
+usr/share/florence/relaxng/svg-graphevents-attrib.rng 27773
+usr/share/florence/relaxng/svg-animevents-attrib.rng 27772
+usr/share/florence/relaxng/svg-xlink-attrib.rng 27771
+usr/share/florence/relaxng/svg-extresources-attrib.rng 27770
+usr/share/florence/relaxng/svg-structure.rng 27769
+usr/share/florence/relaxng/svg-basic-structure.rng 27768
+usr/share/florence/relaxng/svg-datatypes.rng 27767
+usr/share/florence/relaxng/svg-core-attrib.rng 27766
+usr/share/florence/relaxng/svg-conditional.rng 27765
+usr/share/florence/relaxng/svg-image.rng 27764
+usr/share/florence/relaxng/svg-style.rng 27763
+usr/share/florence/relaxng/svg-shape.rng 27762
+usr/share/florence/relaxng/svg-text.rng 27761
+usr/share/florence/relaxng/svg-basic-text.rng 27760
+usr/share/florence/relaxng/svg-marker.rng 27759
+usr/share/florence/relaxng/svg-profile.rng 27758
+usr/share/florence/relaxng/svg-gradient.rng 27757
+usr/share/florence/relaxng/svg-pattern.rng 27756
+usr/share/florence/relaxng/svg-clip.rng 27755
+usr/share/florence/relaxng/svg-basic-clip.rng 27754
+usr/share/florence/relaxng/svg-mask.rng 27753
+usr/share/florence/relaxng/svg-filter.rng 27752
+usr/share/florence/relaxng/svg-basic-filter.rng 27751
+usr/share/florence/relaxng/svg-cursor.rng 27750
+usr/share/florence/relaxng/svg-hyperlink.rng 27749
+usr/share/florence/relaxng/svg-view.rng 27748
+usr/share/florence/relaxng/svg-script.rng 27747
+usr/share/florence/relaxng/svg-animation.rng 27746
+usr/share/florence/relaxng/svg-font.rng 27745
+usr/share/florence/relaxng/svg-basic-font.rng 27744
+usr/share/florence/relaxng/svg-extensibility.rng 27743
+usr/share/florence/florence.css 27742
+usr/share/florence/styles/hard/florence.defs 27741
+bin/df 27740
+usr/bin/tails-upgrade-frontend 27739
+usr/share/perl/5.20.2/FindBin.pm 27738
+usr/lib/i386-linux-gnu/perl/5.20.2/lib.pm 27737
+usr/share/perl5/Tails/IUK/Frontend.pm 27736
+usr/share/perl5/MooseX/Types/Path/Class.pm 27735
+usr/share/perl5/Path/Class.pm 27734
+usr/share/perl5/Path/Class/File.pm 27733
+usr/share/perl5/Path/Class/Dir.pm 27732
+usr/share/perl5/Path/Class/Entity.pm 27731
+usr/share/perl/5.20.2/File/stat.pm 27730
+usr/lib/i386-linux-gnu/perl/5.20.2/IO/Dir.pm 27729
+usr/share/perl/5.20.2/Perl/OSType.pm 27728
+usr/share/perl/5.20.2/File/Copy.pm 27727
+usr/share/perl5/MooseX/Getopt.pm 27726
+usr/share/perl5/MooseX/Getopt/GLD.pm 27725
+usr/share/perl5/MooseX/Role/Parameterized.pm 27724
+usr/share/perl5/MooseX/Role/Parameterized/Meta/Trait/Parameterizable.pm 27723
+usr/share/perl5/MooseX/Role/Parameterized/Meta/Role/Parameterized.pm 27722
+usr/share/perl5/MooseX/Role/Parameterized/Meta/Trait/Parameterized.pm 27721
+usr/share/perl5/MooseX/Role/Parameterized/Parameters.pm 27720
+usr/share/perl5/MooseX/Getopt/Basic.pm 27719
+usr/share/perl5/MooseX/Getopt/OptionTypeMap.pm 27718
+usr/share/perl5/MooseX/Getopt/Meta/Attribute.pm 27717
+usr/share/perl5/MooseX/Getopt/Meta/Attribute/Trait.pm 27716
+usr/share/perl5/MooseX/Getopt/Meta/Attribute/NoGetopt.pm 27715
+usr/share/perl5/MooseX/Getopt/Meta/Attribute/Trait/NoGetopt.pm 27714
+usr/share/perl5/MooseX/Getopt/ProcessedArgv.pm 27713
+usr/share/perl/5.20.2/Env.pm 27712
+usr/share/perl/5.20.2/Tie/Array.pm 27711
+usr/share/perl5/IPC/Run.pm 27710
+usr/share/perl5/IPC/Run/Debug.pm 27709
+usr/share/perl5/IPC/Run/IO.pm 27708
+usr/share/perl5/IPC/Run/Timer.pm 27707
+usr/share/perl5/IPC/Run/SafeHandles.pm 27706
+usr/share/perl5/Number/Format.pm 27705
+usr/share/perl5/String/Errf.pm 27704
+usr/share/perl5/String/Formatter.pm 27703
+usr/lib/i386-linux-gnu/perl/5.20.2/Time/Piece.pm 27702
+usr/lib/i386-linux-gnu/perl/5.20.2/Time/Seconds.pm 27701
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Time/Piece/Piece.so 27700
+usr/share/perl5/Tails/RunningSystem.pm 27699
+usr/share/perl5/Sys/Statistics/Linux/MemStats.pm 27698
+usr/share/perl5/Tails/Constants.pm 27697
+usr/share/perl5/Method/Signatures/Simple.pm 27696
+usr/lib/i386-linux-gnu/perl5/5.20/Devel/Declare/MethodInstaller/Simple.pm 27695
+usr/share/perl5/Tails/UDisks.pm 27694
+usr/share/perl5/Syntax/Keyword/Junction.pm 27693
+usr/share/perl5/Syntax/Keyword/Junction/All.pm 27692
+usr/share/perl5/Syntax/Keyword/Junction/Base.pm 27691
+usr/share/perl5/Syntax/Keyword/Junction/Any.pm 27690
+usr/share/perl5/Syntax/Keyword/Junction/None.pm 27689
+usr/share/perl5/Syntax/Keyword/Junction/One.pm 27688
+usr/lib/i386-linux-gnu/perl5/5.20/Unix/Mknod.pm 27687
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Unix/Mknod/Mknod.so 27686
+usr/share/perl5/Tails/Role/HasDBus/System.pm 27685
+usr/lib/i386-linux-gnu/perl5/5.20/Net/DBus/GLib.pm 27684
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Net/DBus/GLib/GLib.so 27683
+usr/share/perl5/Tails/Role/HasEncoding.pm 27682
+usr/share/perl5/Tails/Role/HasCodeset.pm 27681
+usr/share/perl5/Tails/Role/DisplayError/Gtk3.pm 27680
+usr/share/perl5/Tails/IUK/UpgradeDescriptionFile.pm 27679
+usr/share/perl5/Dpkg/Version.pm 27678
+usr/share/perl5/Dpkg/ErrorHandling.pm 27677
+usr/share/perl5/Dpkg.pm 27676
+usr/share/perl5/Dpkg/Gettext.pm 27675
+usr/share/perl5/YAML/Any.pm 27674
+usr/lib/i386-linux-gnu/perl5/5.20/YAML/XS.pm 27673
+usr/lib/i386-linux-gnu/perl5/5.20/YAML/XS/LibYAML.pm 27672
+usr/lib/i386-linux-gnu/perl5/5.20/auto/YAML/XS/LibYAML/LibYAML.so 27671
+usr/share/perl/5.20.2/B/Deparse.pm 27670
+usr/lib/i386-linux-gnu/perl5/5.20/Moose/Meta/Method/Accessor/Native/Array/clear.pm 27669
+usr/share/perl5/Tails/IUK/Utils.pm 27668
+usr/share/perl/5.20.2/Archive/Tar.pm 27667
+usr/share/perl/5.20.2/IO/Zlib.pm 27666
+usr/share/perl/5.20.2/Compress/Zlib.pm 27665
+usr/share/perl/5.20.2/IO/Compress/Base/Common.pm 27664
+usr/share/perl/5.20.2/File/GlobMapper.pm 27663
+usr/lib/i386-linux-gnu/perl/5.20.2/Compress/Raw/Zlib.pm 27662
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Compress/Raw/Zlib/Zlib.so 27661
+usr/share/perl/5.20.2/IO/Compress/Gzip.pm 27660
+usr/share/perl/5.20.2/IO/Compress/RawDeflate.pm 27659
+usr/share/perl/5.20.2/IO/Compress/Base.pm 27658
+usr/share/perl/5.20.2/IO/Compress/Adapter/Deflate.pm 27657
+usr/share/perl/5.20.2/IO/Compress/Gzip/Constants.pm 27656
+usr/share/perl/5.20.2/IO/Compress/Zlib/Extra.pm 27655
+usr/share/perl/5.20.2/IO/Uncompress/Gunzip.pm 27654
+usr/share/perl/5.20.2/IO/Uncompress/RawInflate.pm 27653
+usr/share/perl/5.20.2/IO/Uncompress/Base.pm 27652
+usr/share/perl/5.20.2/IO/Uncompress/Adapter/Inflate.pm 27651
+usr/share/perl/5.20.2/Tie/Handle.pm 27650
+usr/share/perl/5.20.2/Tie/StdHandle.pm 27649
+usr/share/perl/5.20.2/Archive/Tar/File.pm 27648
+usr/share/perl/5.20.2/Archive/Tar/Constant.pm 27647
+usr/share/perl/5.20.2/IO/Uncompress/Bunzip2.pm 27646
+usr/share/perl/5.20.2/IO/Uncompress/Adapter/Bunzip2.pm 27645
+usr/lib/i386-linux-gnu/perl/5.20.2/Compress/Raw/Bzip2.pm 27644
+usr/lib/i386-linux-gnu/perl/5.20.2/auto/Compress/Raw/Bzip2/Bzip2.so 27643
+usr/share/perl/5.20.2/IO/Compress/Bzip2.pm 27642
+usr/share/perl/5.20.2/IO/Compress/Adapter/Bzip2.pm 27641
+usr/share/perl5/Moo/HandleMoose.pm 27640
+usr/share/perl5/Moo/HandleMoose/FakeMetaClass.pm 27639
+usr/lib/i386-linux-gnu/perl5/5.20/Filesys/Df.pm 27638
+usr/lib/i386-linux-gnu/perl5/5.20/auto/Filesys/Df/Df.so 27637
+usr/share/perl5/Tails/MirrorPool.pm 27636
+usr/share/perl5/Tails/IUK/Role/HasEncoding.pm 27635
+usr/share/perl5/Tails/IUK/Role/HasCodeset.pm 27634
+usr/share/perl5/MooseX/Getopt/Dashes.pm 27633
+usr/bin/tails-iuk-get-upgrade-description-file 27632
+usr/share/perl5/Tails/IUK/UpgradeDescriptionFile/Download.pm 27631
+usr/local/bin/tor-browser 27630
+usr/local/lib/tails-shell-library/tor-browser.sh 27629
+usr/local/lib/tor-browser/firefox 27628
+usr/local/lib/tor-browser/libstdc++.so.6 27627
+usr/local/lib/tor-browser/dependentlibs.list 27626
+usr/local/lib/tor-browser/libnspr4.so 27625
+usr/local/lib/tor-browser/libplc4.so 27624
+usr/local/lib/tor-browser/libplds4.so 27623
+usr/local/lib/tor-browser/libnssutil3.so 27622
+usr/local/lib/tor-browser/libnss3.so 27621
+usr/local/lib/tor-browser/libsmime3.so 27620
+usr/local/lib/tor-browser/libssl3.so 27619
+usr/local/lib/tor-browser/libmozsqlite3.so 27618
+usr/local/lib/tor-browser/liblgpllibs.so 27617
+usr/local/lib/tor-browser/libxul.so 27616
+usr/lib/i386-linux-gnu/gconv/UTF-16.so 27615
+usr/local/lib/tor-browser/TorBrowser/Data/Browser/profiles.ini 27614
+usr/local/lib/tor-browser/omni.ja 27613
+usr/local/lib/tor-browser/browser/omni.ja 27612
+usr/local/lib/tor-browser/defaults/pref/channel-prefs.js 27611
+usr/local/lib/tor-browser/browser/chrome.manifest 27610
+usr/local/lib/tor-browser/browser/components/components.manifest 27609
+usr/local/lib/tor-browser/browser/components/libbrowsercomps.so 27608
+usr/local/lib/tor-browser/TorBrowser/Data/fontconfig/fonts.conf 27607
+usr/local/lib/tor-browser/fonts/Arimo-Bold.ttf 27606
+usr/local/lib/tor-browser/fonts/Arimo-BoldItalic.ttf 27605
+usr/local/lib/tor-browser/fonts/Arimo-Italic.ttf 27604
+usr/local/lib/tor-browser/fonts/Arimo-Regular.ttf 27603
+usr/local/lib/tor-browser/fonts/Cousine-Regular.ttf 27602
+usr/local/lib/tor-browser/fonts/NotoEmoji-Regular.ttf 27601
+usr/local/lib/tor-browser/fonts/NotoNaskhArabic-Regular.ttf 27600
+usr/local/lib/tor-browser/fonts/NotoSansArmenian-Regular.ttf 27599
+usr/local/lib/tor-browser/fonts/NotoSansBengali-Regular.ttf 27598
+usr/local/lib/tor-browser/fonts/NotoSansBuginese-Regular.ttf 27597
+usr/local/lib/tor-browser/fonts/NotoSansCanadianAboriginal-Regular.ttf 27596
+usr/local/lib/tor-browser/fonts/NotoSansCherokee-Regular.ttf 27595
+usr/local/lib/tor-browser/fonts/NotoSansDevanagari-Regular.ttf 27594
+usr/local/lib/tor-browser/fonts/NotoSansEthiopic-Regular.ttf 27593
+usr/local/lib/tor-browser/fonts/NotoSansGeorgian-Regular.ttf 27592
+usr/local/lib/tor-browser/fonts/NotoSansGujarati-Regular.ttf 27591
+usr/local/lib/tor-browser/fonts/NotoSansGurmukhi-Regular.ttf 27590
+usr/local/lib/tor-browser/fonts/NotoSansHebrew-Regular.ttf 27589
+usr/local/lib/tor-browser/fonts/NotoSansJP-Regular.otf 27588
+usr/local/lib/tor-browser/fonts/NotoSansKR-Regular.otf 27587
+usr/local/lib/tor-browser/fonts/NotoSansKannada-Regular.ttf 27586
+usr/local/lib/tor-browser/fonts/NotoSansKhmer-Regular.ttf 27585
+usr/local/lib/tor-browser/fonts/NotoSansLao-Regular.ttf 27584
+usr/local/lib/tor-browser/fonts/NotoSansMalayalam-Regular.ttf 27583
+usr/local/lib/tor-browser/fonts/NotoSansMongolian-Regular.ttf 27582
+usr/local/lib/tor-browser/fonts/NotoSansMyanmar-Regular.ttf 27581
+usr/local/lib/tor-browser/fonts/NotoSansOriya-Regular.ttf 27580
+usr/local/lib/tor-browser/fonts/NotoSansSC-Regular.otf 27579
+usr/local/lib/tor-browser/fonts/NotoSansSinhala-Regular.ttf 27578
+usr/local/lib/tor-browser/fonts/NotoSansTC-Regular.otf 27577
+usr/local/lib/tor-browser/fonts/NotoSansTamil-Regular.ttf 27576
+usr/local/lib/tor-browser/fonts/NotoSansTelugu-Regular.ttf 27575
+usr/local/lib/tor-browser/fonts/NotoSansThaana-Regular.ttf 27574
+usr/local/lib/tor-browser/fonts/NotoSansThai-Regular.ttf 27573
+usr/local/lib/tor-browser/fonts/NotoSansTibetan-Regular.ttf 27572
+usr/local/lib/tor-browser/fonts/NotoSansYi-Regular.ttf 27571
+usr/local/lib/tor-browser/fonts/NotoSerifArmenian-Regular.ttf 27570
+usr/local/lib/tor-browser/fonts/NotoSerifKhmer-Regular.ttf 27569
+usr/local/lib/tor-browser/fonts/NotoSerifLao-Regular.ttf 27568
+usr/local/lib/tor-browser/fonts/NotoSerifThai-Regular.ttf 27567
+usr/local/lib/tor-browser/fonts/STIXMath-Regular.otf 27566
+usr/local/lib/tor-browser/fonts/Tinos-Bold.ttf 27565
+usr/local/lib/tor-browser/fonts/Tinos-BoldItalic.ttf 27564
+usr/local/lib/tor-browser/fonts/Tinos-Italic.ttf 27563
+usr/local/lib/tor-browser/fonts/Tinos-Regular.ttf 27562
+usr/share/icons/Adwaita/cursors/xterm 27561
+usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/immodules.cache 27560
+usr/lib/i386-linux-gnu/gtk-2.0/2.10.0/immodules/im-ibus.so 27559
+usr/local/lib/tor-browser/browser/blocklist.xml 27558
+usr/local/lib/tor-browser/libsoftokn3.so 27557
+usr/local/lib/tor-browser/libfreebl3.so 27556
+usr/local/lib/tor-browser/libnssckbi.so 27555
+usr/local/share/tor-browser-extensions/{73a6fe31-595d-460b-a920-fcc0f8843232}.xpi 27554
+usr/share/xul-ext/ublock-origin/install.rdf 27553
+usr/share/xul-ext/ublock-origin/chrome.manifest 27552
+usr/local/share/tor-browser-extensions/torbutton@torproject.org.xpi 27551
+usr/local/share/tor-browser-extensions/langpack-zh-CN@firefox.mozilla.org.xpi 27550
+usr/local/share/tor-browser-extensions/langpack-vi@firefox.mozilla.org.xpi 27549
+usr/local/share/tor-browser-extensions/langpack-tr@firefox.mozilla.org.xpi 27548
+usr/local/share/tor-browser-extensions/langpack-ru@firefox.mozilla.org.xpi 27547
+usr/local/share/tor-browser-extensions/langpack-pt-BR@firefox.mozilla.org.xpi 27546
+usr/local/share/tor-browser-extensions/langpack-pl@firefox.mozilla.org.xpi 27545
+usr/local/share/tor-browser-extensions/langpack-nl@firefox.mozilla.org.xpi 27544
+usr/local/share/tor-browser-extensions/langpack-ko@firefox.mozilla.org.xpi 27543
+usr/local/share/tor-browser-extensions/langpack-ja@firefox.mozilla.org.xpi 27542
+usr/local/share/tor-browser-extensions/langpack-it@firefox.mozilla.org.xpi 27541
+usr/local/share/tor-browser-extensions/langpack-fr@firefox.mozilla.org.xpi 27540
+usr/local/share/tor-browser-extensions/langpack-fa@firefox.mozilla.org.xpi 27539
+usr/local/share/tor-browser-extensions/langpack-es-ES@firefox.mozilla.org.xpi 27538
+usr/local/share/tor-browser-extensions/langpack-de@firefox.mozilla.org.xpi 27537
+usr/local/share/tor-browser-extensions/langpack-ar@firefox.mozilla.org.xpi 27536
+usr/local/share/tor-browser-extensions/https-everywhere-eff@eff.org.xpi 27535
+usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/install.rdf 27534
+usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/chrome.manifest 27533
+usr/local/lib/tor-browser/browser/extensions/{972ce4c6-7e08-4474-a285-3208198ce6fd}.xpi 27532
+usr/share/xul-ext/ublock-origin/bootstrap.js 27531
+usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/defaults/preferences/prefs.js 27530
+usr/lib/locale/C.UTF-8/LC_IDENTIFICATION 27529
+usr/lib/locale/C.UTF-8/LC_MEASUREMENT 27528
+usr/lib/locale/C.UTF-8/LC_TELEPHONE 27527
+usr/lib/locale/C.UTF-8/LC_ADDRESS 27526
+usr/lib/locale/C.UTF-8/LC_NAME 27525
+usr/lib/locale/C.UTF-8/LC_PAPER 27524
+usr/lib/locale/C.UTF-8/LC_MESSAGES/SYS_LC_MESSAGES 27523
+usr/lib/locale/C.UTF-8/LC_MONETARY 27522
+usr/lib/locale/C.UTF-8/LC_COLLATE 27521
+usr/lib/locale/C.UTF-8/LC_TIME 27520
+usr/lib/locale/C.UTF-8/LC_NUMERIC 27519
+usr/share/icons/hicolor/36x36/emblems/emblem-debian.icon 27518
+usr/share/icons/hicolor/64x64/emblems/emblem-debian.icon 27517
+usr/share/icons/hicolor/128x128/emblems/emblem-debian.icon 27516
+usr/share/icons/hicolor/scalable/emblems/emblem-debian.icon 27515
+usr/local/lib/tor-browser/browser/chrome/icons/default/default16.png 27514
+usr/local/lib/tor-browser/browser/chrome/icons/default/default32.png 27513
+usr/local/lib/tor-browser/browser/chrome/icons/default/default48.png 27512
+usr/local/share/tor-browser-extensions/branding@amnesia.boum.org/chrome/locale/en-US/amnesia.properties 27511
+usr/share/xul-ext/ublock-origin/background.html 27510
+usr/share/mime/application/javascript.xml 27509
+usr/share/xul-ext/ublock-origin/js/polyfill.js 27508
+usr/share/xul-ext/ublock-origin/lib/punycode.js 27507
+usr/share/xul-ext/ublock-origin/lib/publicsuffixlist.js 27506
+usr/share/xul-ext/ublock-origin/lib/yamd5.js 27505
+usr/share/xul-ext/ublock-origin/js/vapi-common.js 27504
+usr/share/xul-ext/ublock-origin/js/vapi-background.js 27503
+usr/share/xul-ext/ublock-origin/js/background.js 27502
+usr/share/xul-ext/ublock-origin/js/utils.js 27501
+usr/share/xul-ext/ublock-origin/js/uritools.js 27500
+usr/share/xul-ext/ublock-origin/js/assets.js 27499
+usr/share/xul-ext/ublock-origin/js/redirect-engine.js 27498
+usr/share/xul-ext/ublock-origin/js/dynamic-net-filtering.js 27497
+usr/share/xul-ext/ublock-origin/js/static-net-filtering.js 27496
+usr/share/xul-ext/ublock-origin/js/url-net-filtering.js 27495
+usr/share/xul-ext/ublock-origin/js/cosmetic-filtering.js 27494
+usr/share/xul-ext/ublock-origin/js/hnswitches.js 27493
+usr/share/xul-ext/ublock-origin/js/ublock.js 27492
+usr/share/xul-ext/ublock-origin/js/messaging.js 27491
+usr/share/xul-ext/ublock-origin/js/profiler.js 27490
+usr/share/xul-ext/ublock-origin/js/storage.js 27489
+usr/share/xul-ext/ublock-origin/js/logger.js 27488
+usr/share/xul-ext/ublock-origin/js/pagestore.js 27487
+usr/share/xul-ext/ublock-origin/js/tab.js 27486
+usr/share/xul-ext/ublock-origin/js/traffic.js 27485
+usr/share/xul-ext/ublock-origin/js/contextmenu.js 27484
+usr/share/xul-ext/ublock-origin/js/reverselookup.js 27483
+usr/share/xul-ext/ublock-origin/js/rpcreceiver.js 27482
+usr/share/xul-ext/ublock-origin/js/start.js 27481
+usr/lib/i386-linux-gnu/libXss.so.1.0.0 27480
+usr/share/xul-ext/ublock-origin/processScript.js 27479
+usr/share/xul-ext/ublock-origin/frameModule.js 27478
+usr/share/xul-ext/ublock-origin/locale/en/messages.properties 27477
+usr/share/xul-ext/ublock-origin/frameScript.js 27476
+usr/share/mime/application/xml.xml 27475
+usr/share/icons/Adwaita/16x16/actions/list-add.png 27474
+usr/share/xul-ext/ublock-origin/img/browsericons/icon16.svg 27473
+etc/tor-controlport-filter.d/onioncircuits.yml 27472
+etc/tor-controlport-filter.d/onionshare.yml 27471
+etc/tor-controlport-filter.d/tor-browser.yml 27470
+etc/tor-controlport-filter.d/tor-launcher.yml 27469
+usr/lib/python3/dist-packages/stem/connection.py 27468
+usr/lib/python3.4/getpass.py 27467
+usr/lib/python3.4/lib-dynload/termios.cpython-34m-i386-linux-gnu.so 27466
+usr/lib/python3/dist-packages/stem/response/add_onion.py 27465
+usr/lib/python3/dist-packages/stem/response/authchallenge.py 27464
+usr/lib/python3/dist-packages/stem/response/getinfo.py 27463
+usr/lib/python3/dist-packages/stem/response/getconf.py 27462
+usr/lib/python3/dist-packages/stem/response/mapaddress.py 27461
+usr/lib/python3/dist-packages/stem/response/protocolinfo.py 27460
+usr/share/themes/Adwaita/gtk-2.0/Arrows/arrow-down.png 27459
+etc/mime.types 27458
+usr/share/mime/application/pdf.xml 27457
+usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/ddg-en-US.xml 27456
+usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/startpage-en-US.xml 27455
+usr/local/lib/tor-browser/distribution/searchplugins/locale/en-US/wikipedia-en-US.xml 27454
+usr/share/xul-ext/ublock-origin/js/vapi-client.js 27453
+usr/share/xul-ext/ublock-origin/js/contentscript.js 27452
+usr/share/themes/Adwaita/gtk-2.0/Others/null.png 27451
+usr/share/themes/Adwaita/gtk-2.0/Entry/entry-border-bg.png 27450
+usr/share/themes/Adwaita/gtk-2.0/Buttons/button-default.png 27449
+usr/share/icons/Adwaita/cursors/hand2 27448
diff --git a/config/chroot_local-includes/usr/share/tails/ublock-origin/ublock0.dump b/config/chroot_local-includes/usr/share/tails/ublock-origin/ublock0.dump
index 73c2eba..b205673 100644
--- a/config/chroot_local-includes/usr/share/tails/ublock-origin/ublock0.dump
+++ b/config/chroot_local-includes/usr/share/tails/ublock-origin/ublock0.dump
@@ -2,24 +2,24 @@ PRAGMA foreign_keys=OFF;
BEGIN TRANSACTION;
CREATE TABLE IF NOT EXISTS "settings" ("name" TEXT PRIMARY KEY NOT NULL, "value" TEXT);
INSERT INTO "settings" VALUES('advancedUserEnabled','false');
-INSERT INTO "settings" VALUES('allowedRequestCount','537');
+INSERT INTO "settings" VALUES('allowedRequestCount','570');
INSERT INTO "settings" VALUES('alwaysDetachLogger','false');
INSERT INTO "settings" VALUES('assets/user/filters.txt','""');
INSERT INTO "settings" VALUES('autoUpdate','false');
INSERT INTO "settings" VALUES('blockedRequestCount','29');
-INSERT INTO "settings" VALUES('cached_asset_content://assets/checksums.txt','"06ee472c87b5ad7e8a2ff74b808bab15 assets/thirdparties/publicsuffix.org/list/effective_tld_names.dat\n
-cd47031e159aa7e67dda4aa31ea515a7 assets/thirdparties/easylist-downloads.adblockplus.org/easyprivacy.txt\n
-f22e1ead1596be882b9f0c5270760867 assets/thirdparties/easylist-downloads.adblockplus.org/easylist.txt\n
-86c79495cd22174049dbf3a9b1a8de47 assets/ublock/unbreak.txt\n
-f3b91943de7b8662b4e2bdc0d68fc706 assets/ublock/resources.txt\n
-fd9c595b155f372080617bc56fa9343f assets/ublock/privacy.txt\n
-5b9cf238c6d9eafbbe6c3464999a0076 assets/ublock/filters.txt\n
+INSERT INTO "settings" VALUES('cached_asset_content://assets/checksums.txt','"56b18eb692248fd0352066c62198c709 assets/ublock/filter-lists.json\n
cadc15e72055199b194392c3e6814948 assets/ublock/badware.txt\n
-56b18eb692248fd0352066c62198c709 assets/ublock/filter-lists.json"');
+59db98eb4de700e4579e1c513d0d0e87 assets/ublock/filters.txt\n
+fd9c595b155f372080617bc56fa9343f assets/ublock/privacy.txt\n
+f3b91943de7b8662b4e2bdc0d68fc706 assets/ublock/resources.txt\n
+86c79495cd22174049dbf3a9b1a8de47 assets/ublock/unbreak.txt\n
+f22e1ead1596be882b9f0c5270760867 assets/thirdparties/easylist-downloads.adblockplus.org/easylist.txt\n
+cd47031e159aa7e67dda4aa31ea515a7 assets/thirdparties/easylist-downloads.adblockplus.org/easyprivacy.txt\n
+06ee472c87b5ad7e8a2ff74b808bab15 assets/thirdparties/publicsuffix.org/list/effective_tld_names.dat"');
INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easylist-downloads.adblockplus.org/easylist.txt','"[Adblock Plus 2.0]\n
-! Version: 201701101722\n
+! Version: 201701230935\n
! Title: EasyList\n
-! Last modified: 10 Jan 2017 17:22 UTC\n
+! Last modified: 23 Jan 2017 09:35 UTC\n
! Expires: 4 days (update frequency)\n
! Homepage: https://easylist.to/\n
! Licence: https://easylist.to/pages/licence.html\n
@@ -627,8 +627,8 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
.popupvideoad.\n
.refit.ads.\n
.rolloverad.\n
-.se/?placement=$script,subdocument,third-party\n
-.se/?redirect&$script,subdocument,third-party\n
+.se/*placement=$script,subdocument,third-party\n
+.se/*redirect&$script,subdocument,third-party\n
.se/ads/\n
.shortcuts.search.\n
.show_ad_\n
@@ -1684,7 +1684,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/adimage?\n
/adimages.\n
/adimages/*$~subdocument\n
-/adimg.\n
+/adimg.$domain=~adimg.ru\n
/adimg/*\n
/adinator/*\n
/adinclude.\n
@@ -1981,6 +1981,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/ads-header-\n
/ads-holder.\n
/ads-inside-\n
+/ads-intros.\n
/ads-leader|\n
/ads-min.\n
/ads-net.\n
@@ -2046,6 +2047,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/ads/?QAPS_\n
/ads/?uniq=\n
/ads/a.\n
+/ads/ab/*\n
/ads/abrad.\n
/ads/acctid=\n
/ads/ad-\n
@@ -4227,6 +4229,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/GoogleAd300.\n
/googlead336x280.\n
/googlead_\n
+/googleadarticle.\n
/GoogleAdBg.\n
/googleadcode.\n
/googleaddfooter.\n
@@ -4374,6 +4377,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/iframeads/*\n
/iframeadsense.\n
/iframeadsensewrapper.\n
+/iFramedAdTemplate/*\n
/iframedartad.\n
/iframes/ad/*\n
/ifrm_ads/*\n
@@ -4461,7 +4465,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/imp.ads/*\n
/impop.\n
/impopup/*\n
-/inad.$domain=~inad.info\n
+/inad.$domain=~inad.com|~inad.info\n
/inc/ad-\n
/inc/ad.\n
/inc/ads/*\n
@@ -5176,6 +5180,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/promobuttonad.\n
/promoloaddisplay?\n
/promoredirect?*&campaign=*&zone=\n
+/PromosAds/*\n
/promotion/geoip/*\n
/promotions/ads.\n
/promotions/ads/*\n
@@ -5538,6 +5543,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
/slider_ad.\n
/sliderAd/*\n
/sliderad3.\n
+/SliderAd_\n
/SliderJobAdList.\n
/slideshow/ads.\n
/slideshowintad?\n
@@ -6140,7 +6146,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
://ad.*/jstag^\n
://adcl.$domain=~adcl.com\n
://ads.$domain=~ads.am|~ads.colombiaonline.com|~ads.msstate.edu|~ads.nc|~ads.route.cc|~ads.sk|~ads.socialtheater.com|~badassembly.com|~caravansforsale.co.uk|~fusac.fr|~memo2.nl|~reempresa.org|~seriouswheels.com\n
-://adv.$domain=~adv.ru|~adv.vg|~adv.works|~advids.co|~erti.se|~escreverdireito.com|~farapp.com|~forex-tv-online.com|~r7.com|~typeform.com|~welaika.com\n
+://adv.$domain=~adv.msk.ru|~adv.ru|~adv.vg|~adv.works|~advids.co|~erti.se|~escreverdireito.com|~farapp.com|~forex-tv-online.com|~r7.com|~typeform.com|~welaika.com\n
://affiliate.$third-party\n
://affiliates.$third-party\n
://ax-d.*/jstag^\n
@@ -6162,6 +6168,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
;adsense_\n
;cue=pre;$object-subrequest\n
;iframeid=ad_\n
+=ad&action=\n
=ad-leaderboard-\n
=ad-rectangle-\n
=ad320x50-\n
@@ -6265,6 +6272,7 @@ INSERT INTO "settings" VALUES('cached_asset_content://assets/thirdparties/easyli
?banner_id=\n
?bannerid=\n
?bannerXGroupId=\n
+?category=ad&\n
?dfpadname=\n
?file=ads&\n
?g1t2h=*&t1m2k3=\n
@@ -6734,6 +6742,7 @@ _paid_ads/\n
_paidadvert_\n
_panel_ads.\n
_partner_ad.\n
+_pcads_\n
_platform_ads.\n
_platform_ads_\n
_player_ads_\n
@@ -6840,6 +6849,7 @@ takeover_banner_\n
/bl.php?*=$script\n
/frontend_loader.js$script,~third-party\n
! prebid scripts\n
+-prebid.$script\n
/biddr-*.js\n
/prebid.$script,domain=~prebid.org\n
/prebid_$script\n
@@ -6853,6 +6863,7 @@ takeover_banner_\n
/webservices/jsparselinks.aspx?$script\n
! CDN-based filters\n
/cdn-cgi/pe/bag2?r*.adroll.com\n
+/cdn-cgi/pe/bag2?r*.codeonclick.com\n
/cdn-cgi/pe/bag2?r*.qualitypublishers.com\n
/cdn-cgi/pe/bag2?r*.worldoffersdaily.com\n
/cdn-cgi/pe/bag2?r*.zergnet.com\n
@@ -6893,6 +6904,7 @@ takeover_banner_\n
! Anti-Adblock\n
-adblocker-detection/\n
/abdetect.js\n
+/abDetector.js\n
/abp_detection/*\n
/ad-blocker.js\n
/ad-blocking-alert/*\n
@@ -7570,8 +7582,11 @@ _a468x60.\n
?iiadext=$popup\n
?zoneid=*_bannerid=$popup\n
_popunder+$popup\n
+! Commonly used popup scripts on movie/tv streaming sites\n
+|javascript:*setTimeout*location.href$popup\n
! Used with many websites to generate multiple popups\n
|data:text$popup\n
+|dddata:text$popup\n
! ------------------------General element hiding rules-------------------------!\n
! *** easylist:easylist/easylist_general_hide.txt ***\n
###A9AdsMiddleBoxTop\n
@@ -7874,6 +7889,7 @@ _popunder+$popup\n
###BigboxAdUnit\n
###BillBoardAdd\n
###BodyAd\n
+###BodyTopAds\n
###BotAd\n
###Bottom468x60AD\n
###BottomAd0\n
@@ -8261,6 +8277,7 @@ _popunder+$popup\n
###ad-300-additional\n
###ad-300-detail\n
###ad-300-sidebar\n
+###ad-300X250-2\n
###ad-300a\n
###ad-300b\n
###ad-300x-container\n
@@ -11497,6 +11514,7 @@ _popunder+$popup\n
###bottomAdvBox\n
###bottomBannerAd\n
###bottomContentAd\n
+###bottomDDAd\n
###bottomFullAd\n
###bottomGoogleAds\n
###bottomLeftAd\n
@@ -12203,6 +12221,7 @@ _popunder+$popup\n
###div-id-for-interstitial-ad\n
###div-insticator-ad-1\n
###div-insticator-ad-2\n
+###div-social-ads\n
###div-vip-ad-banner\n
###div-web-ad-billboard\n
###div-web-ad-content-article\n
@@ -12265,6 +12284,7 @@ _popunder+$popup\n
###dlads\n
###dni-advertising-skyscraper-wrapper\n
###dni-header-ad\n
+###dnn_AdBannerPane\n
###dnn_Advertisement\n
###dnn_adSky\n
###dnn_adTop\n
@@ -12736,6 +12756,7 @@ _popunder+$popup\n
###halfPageAd\n
###halfe-page-ad-box\n
###hb-header-ad\n
+###hcf-ad-wrapper\n
###hd-ads\n
###hd-banner-ad\n
###hd_ad\n
@@ -13303,6 +13324,7 @@ _popunder+$popup\n
###li-right-geobooster-oas\n
###ligatus\n
###ligatusdiv\n
+###lightboxAd\n
###lilo_imageAd\n
###linebreak-ads\n
###linkAdSingle\n
@@ -13365,6 +13387,7 @@ _popunder+$popup\n
###main-content-adcontent1\n
###main-header-ad-wrap\n
###main-header-ad-wrap-home\n
+###main-header-advertisement\n
###main-middle-ad\n
###main-right-ad-tray\n
###main-tj-ad\n
@@ -13680,6 +13703,7 @@ _popunder+$popup\n
###oas_Middle\n
###oas_Middle1\n
###oas_Right\n
+###oas_Right1\n
###oas_Right2\n
###oas_Top\n
###oas_Top1\n
@@ -14497,6 +14521,7 @@ _popunder+$popup\n
###sponseredlinks\n
###sponsor-flyout-wrap\n
###sponsor-links\n
+###sponsor-sidebar-container\n
###sponsorAd\n
###sponsorAd1\n
###sponsorAd2\n
@@ -14646,6 +14671,7 @@ _popunder+$popup\n
###stationad\n
###sticky-ad\n
###sticky-ad-container\n
+###sticky-top-ad-spacer\n
###sticky-top-ad-wrap\n
###stickyAdBlock\n
###stickyBottomAd\n
@@ -16096,6 +16122,8 @@ _popunder+$popup\n
##.ad-hdr\n
##.ad-head\n
##.ad-header\n
+##.ad-header-container\n
+##.ad-header-pencil\n
##.ad-header-sidebar\n
##.ad-heading\n
##.ad-headliner-container\n
@@ -16317,6 +16345,7 @@ _popunder+$popup\n
##.ad-scl\n
##.ad-script-processed\n
##.ad-scroll\n
+##.ad-scrollpane\n
##.ad-search-grid\n
##.ad-section\n
##.ad-section-body\n
@@ -17131,6 +17160,7 @@ _popunder+$popup\n
##.ad__container\n
##.ad__in-loop\n
##.ad__in-loop--desktop\n
+##.ad__inline\n
##.ad__label\n
##.ad__leaderboard\n
##.ad__mpu\n
@@ -18265,6 +18295,7 @@ _popunder+$popup\n
##.ads_leader\n
##.ads_leaderboard\n
##.ads_left\n
+##.ads_linkb_728\n
##.ads_loc_bottom\n
##.ads_loc_side\n
##.ads_lr_wrapper\n
@@ -18321,6 +18352,8 @@ _popunder+$popup\n
##.ads_top_both\n
##.ads_top_promo\n
##.ads_topbanner\n
+##.ads_topic_300\n
+##.ads_topic_after\n
##.ads_topleft\n
##.ads_topright\n
##.ads_tower\n
@@ -18359,6 +18392,7 @@ _popunder+$popup\n
##.adsbox_300x250\n
##.adsboxitem\n
##.adsbttmpg\n
+##.adsbycircumventioncentral\n
##.adsbygoogle\n
##.adsbygoogle-box\n
##.adsbygoogle2\n
@@ -18493,6 +18527,7 @@ _popunder+$popup\n
##.adseparator\n
##.adserve_728\n
##.adserver_zone\n
+##.adserving\n
##.adset\n
##.adsforums\n
##.adsghori\n
@@ -18702,6 +18737,7 @@ _popunder+$popup\n
##.adv-label\n
##.adv-leaderboard\n
##.adv-leaderboard-banner\n
+##.adv-lshaped-wrapper\n
##.adv-mid-rect\n
##.adv-mpu\n
##.adv-outer\n
@@ -19072,11 +19108,13 @@ _popunder+$popup\n
##.advertisement-bottom\n
##.advertisement-caption\n
##.advertisement-cell\n
+##.advertisement-comment\n
##.advertisement-container\n
##.advertisement-content\n
##.advertisement-copy\n
##.advertisement-dashed\n
##.advertisement-header\n
+##.advertisement-information-link\n
##.advertisement-label\n
##.advertisement-label-up-white\n
##.advertisement-layout\n
@@ -19452,6 +19490,7 @@ _popunder+$popup\n
##.as-admedia\n
##.as_ad\n
##.aseadn\n
+##.aside-ad\n
##.aside-ad-wrapper\n
##.aside-ads\n
##.asideAd\n
@@ -19897,6 +19936,7 @@ _popunder+$popup\n
##.bottom-large-google-ad\n
##.bottom-leaderboard-adslot\n
##.bottom-left-ad\n
+##.bottom-main-adsense\n
##.bottom-mpu-ad\n
##.bottom-right-advert\n
##.bottom-rightadvtsment\n
@@ -20412,6 +20452,7 @@ _popunder+$popup\n
##.ctnAdSquare300\n
##.ctn_ads_rhs\n
##.ctn_ads_rhs_organic\n
+##.ctpl-duplicated-ad\n
##.ctr-tss-ads\n
##.cube-ad\n
##.cubeAd\n
@@ -20623,6 +20664,7 @@ _popunder+$popup\n
##.east_ad_bg\n
##.east_ad_block\n
##.easy-ads\n
+##.easyAdsBox\n
##.easyAdsSinglePosition\n
##.easyazon-block\n
##.eb_ad280\n
@@ -20857,6 +20899,7 @@ _popunder+$popup\n
##.ftv-ad-sumo\n
##.full-ad\n
##.full-width-ad\n
+##.full-width-ad-container\n
##.fullSizeAd\n
##.full_ad_box\n
##.full_ad_row\n
@@ -20977,6 +21020,7 @@ _popunder+$popup\n
##.gn_ads\n
##.go-ad\n
##.go-ads-widget-ads-wrap\n
+##.goglad\n
##.goog_ad\n
##.googad\n
##.googads\n
@@ -21324,6 +21368,7 @@ _popunder+$popup\n
##.home-area3-adv-text\n
##.home-body-ads\n
##.home-features-ad\n
+##.home-sidebar-ad\n
##.home-sidebar-ad-300\n
##.home-slider-ads\n
##.home-sponsored-links\n
@@ -21397,6 +21442,7 @@ _popunder+$popup\n
##.horisont_ads\n
##.horiz_adspace\n
##.horizontal-ad-holder\n
+##.horizontal-ad2\n
##.horizontalAd\n
##.horizontalAdText\n
##.horizontalAdvert\n
@@ -21464,6 +21510,7 @@ _popunder+$popup\n
##.icon-myindependentad\n
##.iconAdChoices\n
##.icon_ad_choices\n
+##.iconads\n
##.id-Advert\n
##.id-Article-advert\n
##.idGoogleAdsense\n
@@ -22125,6 +22172,7 @@ _popunder+$popup\n
##.mobile_featuredad\n
##.mobile_featuredad_article\n
##.mobileadbig\n
+##.mobilesideadverts\n
##.mod-ad\n
##.mod-ad-1\n
##.mod-ad-2\n
@@ -22575,6 +22623,7 @@ _popunder+$popup\n
##.pb-mod-ad-flex\n
##.pb-mod-ad-leaderboard\n
##.pc-ad\n
+##.pcads_widget\n
##.pd-ads-mpu\n
##.peg_ad\n
##.pencil-ad\n
@@ -23243,6 +23292,7 @@ _popunder+$popup\n
##.side-ad-big\n
##.side-ad-blocks\n
##.side-ad-container\n
+##.side-ad-inner\n
##.side-ads\n
##.side-ads-block\n
##.side-ads-wide\n
@@ -23297,6 +23347,7 @@ _popunder+$popup\n
##.sideadsbox\n
##.sideadtable\n
##.sideadvert\n
+##.sideadverts\n
##.sidebar--mps_ad\n
##.sidebar-350ad\n
##.sidebar-above-medium-rect-ad-unit\n
@@ -23318,6 +23369,7 @@ _popunder+$popup\n
##.sidebar-ad-slot\n
##.sidebar-adbox\n
##.sidebar-ads\n
+##.sidebar-adv-container\n
##.sidebar-advertisement\n
##.sidebar-atf-ad-wrapper\n
##.sidebar-below-ad-unit\n
@@ -24023,7 +24075,9 @@ _popunder+$popup\n
##.thumbnailad\n
##.tibu_ad\n
##.ticket-ad\n
+##.tile--ad\n
##.tile-ad\n
+##.tile-ad-container\n
##.tileAdContainer\n
##.tileAdWrap\n
##.tileAds\n
@@ -24240,12 +24294,16 @@ _popunder+$popup\n
##.trc-content-sponsored\n
##.trc-content-sponsoredUB\n
##.treeAdBlockWithBanner_right\n
+##.trending__ad\n
##.tribal-ad\n
##.trip_ad_center\n
##.trueads\n
+##.ts-ad\n
+##.ts-ad-leaderboard\n
##.ts-ad_unit_bigbox\n
##.ts-banner_ad\n
##.ts-featured_ad\n
+##.ts-sponsored-links\n
##.ts-top-most-ads\n
##.tsmAd\n
##.tt_ads\n
@@ -24310,6 +24368,7 @@ _popunder+$popup\n
##.vAds\n
##.v_ad\n
##.vadvert\n
+##.variableHeightAd\n
##.vbox-verticalad\n
##.ve2_post_adsense\n
##.vert-ad\n
@@ -24517,9 +24576,11 @@ _popunder+$popup\n
##.widget_customad_widget\n
##.widget_customadvertising\n
##.widget_cxad\n
+##.widget_dfp\n
##.widget_dfp_lb-widget\n
##.widget_econaabachoadswidget\n
##.widget_emads\n
+##.widget_etcenteredadwidget\n
##.widget_evolve_ad_gpt_widget\n
##.widget_fearless_responsive_image_ad\n
##.widget_googleads\n
@@ -24700,10 +24761,12 @@ _popunder+$popup\n
##a[href*=\".adsrv.eacdn.com/\"] > img\n
##a[href*=\".qertewrt.com/\"]\n
##a[href*=\"/adrotate-out.php?\"]\n
+##a[href*=\"/cmd.php?ad=\"]\n
##a[href*=\"=Adtracker\"]\n
##a[href*=\"ad2upapp.com/\"]\n
##a[href*=\"emprestimo.eu\"]\n
##a[href*=\"friendlyduck.com\"]\n
+##a[href*=\"googleme.eu\"]\n
##a[href*=\"letsadvertisetogether.com\"]\n
##a[href^=\" http://ads.ad-center.com/\"]\n
##a[href^=\" http://n47adshostnet.com/\"]\n
@@ -25669,6 +25732,7 @@ racingjunk.com#@#.featuredAdBox\n
webphunu.net#@#.flash-advertisement\n
songlyrics.com#@#.footer-ad\n
employmentguide.com#@#.footer-ads\n
+selectparkhomes.com#@#.footer_ad\n
koopik.com#@#.footerad\n
ebayclassifieds.com,guloggratis.dk#@#.gallery-ad\n
time.com#@#.google-sponsored\n
@@ -25677,7 +25741,7 @@ nicovideo.jp#@#.googleAds\n
davidsilverspares.co.uk#@#.greyAd\n
waer.org#@#.has-ad\n
minecraftforge.net#@#.hasads\n
-adexchanger.com,assetbar.com,burningangel.com,donthatethegeek.com,drunkenstepfather.com,intomobile.com,poderpda.com,politicususa.com,startingstrongman.com,thenationonlineng.net,thinkcomputers.org,wccftech.com,wholelifestylenutrition.com#@#.header-ad\n
+adexchanger.com,assetbar.com,burningangel.com,donthatethegeek.com,drunkenstepfather.com,intomobile.com,poderpda.com,politicususa.com,seattlepi.com,sfgate.com,startingstrongman.com,thenationonlineng.net,thinkcomputers.org,wccftech.com,wholelifestylenutrition.com#@#.header-ad\n
greenbayphoenix.com,photobucket.com#@#.headerAd\n
dailytimes.com.pk,swns.com#@#.header_ad\n
associatedcontent.com#@#.header_ad_center\n
@@ -25757,7 +25821,7 @@ mail.yahoo.com#@#.searchad\n
avizo.cz,bisexual.com#@#.searchads\n
ipsluk.co.uk#@#.section-sponsor\n
arbetsformedlingen.se,wunderground.com#@#.showAd\n
-agelioforos.gr,domainrural.com.au#@#.side-ad\n
+agelioforos.gr,audioholics.com,domainrural.com.au#@#.side-ad\n
suntimes.com#@#.side-bar-ad-position1\n
timesofoman.com#@#.sideAd\n
fool.com#@#.sidebar-ads\n
@@ -25851,7 +25915,6 @@ spoilertv.com#@##adsensewide\n
anisearch.com,lilfile.com#@##advertise\n
yafud.pl#@##bottomAd\n
liberallogic101.com#@##headerAd\n
-dizi-mag.com#@##header_ad\n
thesimsresource.com#@##leaderboardad\n
exashare.com#@##player_ads\n
iphone-tv.eu#@##sidebar_ad\n
@@ -25887,6 +25950,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
! ---------------------------Third-party advertisers---------------------------!\n
! *** easylist:easylist/easylist_adservers.txt ***\n
||007-gateway.com^$third-party\n
+||04dn8g4f.space^$third-party\n
+||0emn.com^$third-party\n
||0fmm.com^$third-party\n
||0icep80f.com^$third-party\n
||0pixl.com^$third-party\n
@@ -26093,11 +26158,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||adbit.co^$third-party\n
||adbma.com^$third-party\n
||adboost.com^$third-party\n
+||adbooth.com^$third-party\n
||adbooth.net^$third-party\n
||adbrau.com^$third-party\n
||adbrite.com^$third-party\n
||adbroo.com^$third-party\n
||adbrook.com^$third-party\n
+||adbuff.com^$third-party\n
||adbull.com^$third-party\n
||adbureau.net^$third-party\n
||adbutler.com^$third-party\n
@@ -26143,6 +26210,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||adespresso.com^$third-party\n
||adexc.net^$third-party\n
||adexchange.io^$third-party\n
+||adexchangeprediction.com^$third-party\n
||adexcite.com^$third-party\n
||adexprt.com^$third-party\n
||adexprts.com^$third-party\n
@@ -26291,7 +26359,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||adonweb.ru^$third-party\n
||adoperator.com^$third-party\n
||adoptim.com^$third-party\n
-||adoric.com^$third-party\n
||adorika.com^$third-party\n
||adorika.net^$third-party\n
||adotic.com^$third-party\n
@@ -26755,6 +26822,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||azorbe.com^$third-party\n
||b117f8da23446a91387efea0e428392a.pl^$third-party\n
||b2s1uqa6.download^$third-party\n
+||b4banner.in^$third-party\n
||b6508157d.website^$third-party\n
||babbnrs.com^$third-party\n
||backbeatmedia.com^$third-party\n
@@ -26830,6 +26898,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||bet365affiliates.com^$third-party\n
||betaffs.com^$third-party\n
||betoga.com^$third-party\n
+||betpartners.it^$third-party\n
||betrad.com^$third-party\n
||bettingpartners.com^$third-party\n
||bf-ad.net^$third-party\n
@@ -26900,6 +26969,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||bororas.com^$third-party\n
||bostonparadise.com^$third-party\n
||bostonwall.com^$third-party\n
+||bounce.bar^$third-party\n
||boydadvertising.co.uk^$third-party\n
||boylesportsreklame.com^$third-party\n
||bpasyspro.com^$third-party\n
@@ -26919,7 +26989,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||bravenetmedianetwork.com^$third-party\n
||breadpro.com^$third-party\n
||brealtime.com^$third-party\n
-||breezybath.com^$third-party\n
||brethrengenotypeteledyne.com^$third-party\n
||bridgetrack.com^$third-party\n
||brighteroption.com^$third-party\n
@@ -26965,6 +27034,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||bwknu1lo.top^$third-party\n
||byspot.com^$third-party\n
||byzoo.org^$third-party\n
+||bznclicks.com^$third-party\n
||c-on-text.com^$third-party\n
||c-planet.net^$third-party\n
||c03jij5q.website^$third-party\n
@@ -27119,6 +27189,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||coguan.com^$third-party\n
||coinad.com^$third-party\n
||coinadvert.net^$third-party\n
+||coinmedia.co^$third-party\n
||coinsicmp.com^$third-party\n
||cointraffic.in^$third-party\n
||cointraffic.io^$third-party\n
@@ -27599,6 +27670,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||ezadserver.net^$third-party\n
||ezmob.com^$third-party\n
||ezoic.net^$third-party\n
+||facebooker.top^$third-party\n
||faggrim.com^$third-party\n
||fairadsnetwork.com^$third-party\n
||falkag.net^$third-party\n
@@ -27882,6 +27954,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||hits.sys.lv^$third-party\n
||hitwastedgarden.com^$third-party\n
||hlads.com^$third-party\n
+||hlu9tseh.men^$third-party\n
||hmongcash.com^$third-party\n
||hokaybo.com^$third-party\n
||hola-shopping.com^$third-party\n
@@ -27923,6 +27996,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||hypemakers.net^$third-party\n
||hyperbanner.net^$third-party\n
||hyperlinksecure.com^$third-party\n
+||hyperpromote.com^$third-party\n
||hypertrackeraff.com^$third-party\n
||hypervre.com^$third-party\n
||hyperwebads.com^$third-party\n
@@ -28051,6 +28125,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||invernetter.info^$third-party\n
||investingchannel.com^$third-party\n
||inviziads.com^$third-party\n
+||iocawy99.science^$third-party\n
||ip-adress.com^$third-party\n
||ipowercdn.com^$third-party\n
||ipredictive.com^$third-party\n
@@ -28280,6 +28355,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||lzjl.com^$third-party\n
||m1.fwmrm.net^$object-subrequest,third-party\n
||m10s8.com^$third-party\n
+||m2.ai^$third-party\n
||m2pub.com^$third-party\n
||m4pub.com^$third-party\n
||m57ku6sm.com^$third-party\n
@@ -28394,7 +28470,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||metaffiliation.com^$~image,~subdocument,third-party,domain=~netaffiliation.com\n
||metaffiliation.com^*^maff=\n
||metaffiliation.com^*^taff=\n
-||metapelite.com^$third-party\n
||metavertising.com^$third-party\n
||metavertizer.com^$third-party\n
||metogo.work^$third-party\n
@@ -28416,6 +28491,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||milabra.com^$third-party\n
||mindlytix.com^$third-party\n
||minimumpay.info^$third-party\n
+||minodazi.com^$third-party\n
||mintake.com^$third-party\n
||mirago.com^$third-party\n
||mirrorpersonalinjury.co.uk^$third-party\n
@@ -28557,6 +28633,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||networld.hk^$third-party\n
||networldmedia.net^$third-party\n
||neudesicmediagroup.com^$third-party\n
+||new-new-years.com^$third-party\n
||newdosug.eu^$third-party\n
||newgentraffic.com^$third-party\n
||newideasdaily.com^$third-party\n
@@ -28737,6 +28814,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||pantherads.com^$third-party\n
||paperg.com^$third-party\n
||paradocs.ru^$third-party\n
+||parkingcrew.net^$third-party\n
||partner-ads.com^$third-party\n
||partner.googleadservices.com^$third-party\n
||partner.video.syndication.msn.com^$~object-subrequest,third-party\n
@@ -28795,6 +28873,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||pioneeringad.com^$third-party\n
||pip-pip-pop.com^$third-party\n
||pipeaota.com^$third-party\n
+||pipsol.net^$third-party\n
||piticlik.com^$third-party\n
||pivotalmedialabs.com^$third-party\n
||pivotrunner.com^$third-party\n
@@ -28877,6 +28956,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||prebid.org^$third-party\n
||precisionclick.com^$third-party\n
||predictad.com^$third-party\n
+||predictivadnetwork.com^$third-party\n
||prestadsng.com^$third-party\n
||prexista.com^$third-party\n
||prf.hn^$third-party\n
@@ -28931,6 +29011,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||publicidad.net^$third-party\n
||publicityclerks.com^$third-party\n
||publicsunrise.link^$third-party\n
+||publir.com^$third-party\n
||publisher.to^$third-party\n
||publisheradnetwork.com^$third-party\n
||pubmatic.com^$third-party\n
@@ -28971,6 +29052,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||quantumads.com^$third-party\n
||queenmult.link^$third-party\n
||quensillo.com^$third-party\n
+||queryly.com^$third-party\n
||questionmarket.com^$third-party\n
||questus.com^$third-party\n
||quickcash500.com^$third-party\n
@@ -29083,7 +29165,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||rkgnmwre.site^$third-party\n
||rmxads.com^$third-party\n
||rnmd.net^$third-party\n
-||roastedvoice.com^$third-party\n
||robocat.me^$third-party\n
||rocketier.net^$third-party\n
||rogueaffiliatesystem.com^$third-party\n
@@ -29096,6 +29177,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||rotorads.com^$third-party\n
||rovion.com^$third-party\n
||roxyaffiliates.com^$third-party\n
+||rpts.org^$third-party\n
||rtbidder.net^$third-party\n
||rtbmedia.org^$third-party\n
||rtbpop.com^$third-party\n
@@ -29115,6 +29197,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||s.adroll.com^$third-party\n
||s2d6.com^$third-party\n
||sa.entireweb.com^$third-party\n
+||sa2eoqu.bid^$third-party\n
||safeadnetworkdata.net^$third-party\n
||safecllc.com^$third-party\n
||safelistextreme.com^$third-party\n
@@ -29173,7 +29256,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||servedbyopenx.com^$third-party\n
||servemeads.com^$third-party\n
||servicegetbook.net^$third-party\n
-||serving-sys.com^$third-party\n
+||serving-sys.com/BurstingPipe/$third-party\n
||serving-system.com^$third-party\n
||sethads.info^$third-party\n
||sev4ifmxa.com^$third-party\n
@@ -29187,6 +29270,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||sharegods.com^$third-party\n
||shareresults.com^$third-party\n
||sharethrough.com^$third-party\n
+||shipthankrecognizing.info^$third-party\n
||shokala.com^$third-party\n
||shoogloonetwork.com^$third-party\n
||shopalyst.com^$third-party\n
@@ -29423,6 +29507,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||teosredic.com^$third-party\n
||teracent.net^$third-party\n
||teracreative.com^$third-party\n
+||teraxhif.com^third-party\n
||terraclicks.com^$third-party\n
||teschenite.com^$third-party\n
||testfilter.com^$third-party\n
@@ -29525,6 +29610,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||tradeexpert.net^$third-party\n
||tradepopups.com^$third-party\n
||traff-advertazer.com^$third-party\n
+||traffads.su^$third-party\n
||traffboost.net^$third-party\n
||traffic-supremacy.com^$third-party\n
||trafficbarads.com^$third-party\n
@@ -29557,6 +29643,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||travelscream.com^$third-party\n
||travidia.com^$third-party\n
||tredirect.com^$third-party\n
+||treksol.net^$third-party\n
||trenpyle.com^$third-party\n
||triadmedianetwork.com^$third-party\n
||tribalfusion.com^$third-party\n
@@ -29832,9 +29919,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||wwwpromoter.com^$third-party\n
||x.mochiads.com^$third-party\n
||x4300tiz.com^$third-party\n
+||x8bhr.com^$third-party\n
||xad.com^$third-party\n
||xadcentral.com^$third-party\n
||xaxoro.com^$third-party\n
+||xbfk51p7.review^$third-party\n
||xcelltech.com^$third-party\n
||xcelsiusadserver.com^$third-party\n
||xchangebanners.com^$third-party\n
@@ -29901,6 +29990,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||youradexchange.com^$third-party\n
||yourfastpaydayloans.com^$third-party\n
||yourlegacy.club^$third-party\n
+||youroffers.win^$third-party\n
||yourquickads.com^$third-party\n
||youwatchtools.com^$third-party\n
||ytsa.net^$third-party\n
@@ -29984,6 +30074,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||wapdollar.in^$third-party\n
||waptrick.com^$third-party\n
||yieldmo.com^$third-party\n
+! Admiral\n
+||brassrule.com^$third-party\n
+||breezybath.com^$third-party\n
+||fanaticalfly.com^$third-party\n
+||metapelite.com^$third-party\n
+||roastedvoice.com^$third-party\n
! Non-English (instead of whitelisting ads)\n
||adhood.com^$third-party\n
||atresadvertising.com^$third-party\n
@@ -30038,12 +30134,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||afqwfxkjmgwv.com^$third-party\n
||agpnzrmptmos.com^$third-party\n
||ahkpdnrtjwat.com^$third-party\n
+||ahzybvwdwrhi.com^$third-party\n
||aiiaqehoqgrj.com^$third-party\n
||aiypulgy.com^$third-party\n
||ajaeihzlcwvn.com^$third-party\n
||ajgffcat.com^$third-party\n
||ajmggjgrardn.com^$third-party\n
||ajxftwwmlinv.com^$third-party\n
+||akrzgxzjynpi.com^$third-party\n
||alasdzdnfvtj.com^$third-party\n
||alvivigqrogq.com^$third-party\n
||ambqphwf.com^$third-party\n
@@ -30103,6 +30201,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||bocksnabswdq.com^$third-party\n
||bqptlqmtroto.com^$third-party\n
||bqqjowpigdnx.com^$third-party\n
+||brqrtgjklary.com^$third-party\n
||bsaixnxcpaai.com^$third-party\n
||bspjagxietut.com^$third-party\n
||bsupflnjmuzn.com^$third-party\n
@@ -30136,6 +30235,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||chxfeymgmwbo.com^$third-party\n
||cihnrhqwbcsq.com^$third-party\n
||cixjmaxkemzknxxuyvkbzlhvvgeqmzgopppvefpfkqdraonoez.com^$third-party\n
+||cjnoeafncyzb.com^$third-party\n
||cjvgnswapbqo.com^$third-party\n
||cjxkzkzmdomd.com^$third-party\n
||ckwpsghi.com^$third-party\n
@@ -30178,6 +30278,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||ddprxzxnhzbq.com^$third-party\n
||dgmlubjidcxc.com^$third-party\n
||dgwrxyucxpizivncznkpmdhtrdzyyylpoeitiannqfxmdzpmwx.com^$third-party\n
+||dhlnlwxspczc.com^$third-party\n
||disbkzufvqhk.com^$third-party\n
||ditouyldfqgt.com^$third-party\n
||diysqcbfyuru.com^$third-party\n
@@ -30198,6 +30299,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||dovltuzibsfs.com^$third-party\n
||dpallyihgtgu.com^$third-party\n
||dppcevxbshdl.com^$third-party\n
+||drbwugautcgh.com^$third-party\n
||drtqfejznjnl.com^$third-party\n
||dsevjzklcjjb.com^$third-party\n
||dsmysdzjhxot.com^$third-party\n
@@ -30219,11 +30321,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||ecmeqhxevxgmtoxubrjstrrlyfgrrtqhvafyagettmwnwkwltn.com^$third-party\n
||ectbduztanog.com^$third-party\n
||edvbyybaviln.com^$third-party\n
+||edwywpsufuda.com^$third-party\n
||eejcqlenlsko.com^$third-party\n
||eeqabqioietkquydwxfgvtvpxpzkuilfcpzkplhcckoghwgacb.com^$third-party\n
||eerdckbwujcx.com^$third-party\n
||ehnjtmqchrub.com^$third-party\n
||eidzaqzygtvq.com^$third-party\n
+||eifbewnmtgpi.com^$third-party\n
+||eiibdnjlautz.com^$third-party\n
||ejgxyfzciwyi.com^$third-party\n
||ejjrckrhigez.com^$third-party\n
||ejwmxjttljbe.com^$third-party\n
@@ -30239,13 +30344,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||eovkzcueutgf.com^$third-party\n
||epesogtigole.com^$third-party\n
||epgooipixbbo.com^$third-party\n
+||erbsqnmglmnv.com^$third-party\n
||erkwkjfompvt.com^$third-party\n
||erszwzaidmlc.com^$third-party\n
||ervpgpxr.com^$third-party\n
||eslgydoqbedo.com^$third-party\n
||eslydbnukkme.com^$third-party\n
||esnirgskobfj.com^$third-party\n
+||etggiddfdaqd.com^$third-party\n
||evhvoeqfrlsb.com^$third-party\n
+||exnyzdboihvi.com^$third-party\n
||ezbtpdjeimlv.com^$third-party\n
||ezuosstmbcle.com^$third-party\n
||farkkbndawtxczozilrrrunxflspkyowishacdueiqzeddsnuu.com^$third-party\n
@@ -30270,8 +30378,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^=\"div-gpt-ad\"
||fkrrvhoierty.com^$third-party\n
||fluohbiy.com^$third-party\n
||flzelfqolfnf.com^$third-party\n
+||fmuxugcqucuu.com^$third-party\n
||fmzxzkgmpmrx.com^$third-party\n
||fneheruhxqtv.com^$third-party\n
+||fnjcriccyuna.com^$third-party\n
||fokisduu.com^$third-party\n
||fpbmjwoebzby.com^$third-party\n
||fppupmqbydpk.com^$third-party\n
@@ -30295,6 +30405,8 @@ coingamez.com,ma